-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TAS2R38 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 150-250 of human TAS2R38 (NP_789787.4) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TAS2R38 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 150-250 of human TAS2R38 (NP_789787.4) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05280A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TAS2R38 |
| Target Synonyms | PTC; T2R38; T2R61; THIOT; TAS2R38 | Form | Liquid |
| Species Reactivity | Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat thymus | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 150-250 of human TAS2R38 (NP_789787.4). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | CSCICTVLCVWCFFSRPHFTVTTVLFMNNNTRLNWQIKDLNLFYSFLFCYLWSVPPFLLFLVSSGMLTVSLGRHMRTMKVYTRNSRDPSLEAHIKALKSLV | Uniprot ID | P59533 |
Uniprot Id
P59533
Target Species
Human
Target Name
TAS2R38
Target Full Name
Taste receptor type 2 member 38
Target Function
Receptor that may play a role in the perception of bitterness and is gustducin-linked. May play a role in sensing the chemical composition of the gastrointestinal content. The activity of this receptor may stimulate alpha gustducin, mediate PLC-beta-2 activation and lead to the gating of TRPM5.
Target Subcellular Location
Membrane; Multi-pass membrane protein.
Target Protein Families
G-protein coupled receptor T2R family
Target Tissue Specificity
Expressed in subsets of taste receptor cells of the tongue and exclusively in gustducin-positive cells. Expressed in testis.
Target Synonyms
PTC; PTC bitter taste receptor; T2R38; T2R38_HUMAN; T2R61; TAS2R38; Taste 2 receptor member 38; Taste receptor type 2 member 38; Taste receptor type 2 member 61; taste receptor; type 2; member 38
Target Background
This gene encodes a seven-transmembrane G protein-coupled receptor that controls the ability to taste glucosinolates, a family of bitter-tasting compounds found in plants of the Brassica sp. Synthetic compounds phenylthiocarbamide (PTC) and 6-n-propylthiouracil (PROP) have been identified as ligands for this receptor and have been used to test the genetic diversity of this gene. Although several allelic forms of this gene have been identified worldwide, there are two predominant common forms (taster and non-taster) found outside of Africa. These alleles differ at three nucleotide positions resulting in amino acid changes in the protein (A49P, A262V, and V296I) with the amino acid combination PAV identifying the taster variant (and AVI identifying the non-taster variant).
Notification