-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TAX1BP3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human TAX1BP3 (NP_055419.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TAX1BP3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human TAX1BP3 (NP_055419.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-14280A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TAX1BP3 |
| Target Synonyms | TIP1; TIP-1; TAX1BP3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, NIH/3T3, MCF7, Mouse lung, Rat lung | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human TAX1BP3 (NP_055419.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSYIPGQPVTAVVQRVEIHKLRQGENLILGFSIGGGIDQDPSQNPFSEDKTDKGIYVTRVSEGGPAEIAGLQIGDKIMQVNGWDMTMVTHDQARKRLTKR | Uniprot ID | O14907 |
Uniprot Id
O14907
Target Species
Human
Target Name
TAX1BP3
Target Full Name
Tax1-binding protein 3
Target Function
May regulate a number of protein-protein interactions by competing for PDZ domain binding sites. Binds CTNNB1 and may thereby act as an inhibitor of the Wnt signaling pathway. Competes with LIN7A for KCNJ4 binding, and thereby promotes KCNJ4 internalization. May play a role in the Rho signaling pathway. May play a role in activation of CDC42 by the viral protein HPV16 E6.
Target Subcellular Location
Cytoplasm. Nucleus. Cell membrane; Peripheral membrane protein; Cytoplasmic side. Note=Recruited to the cell membrane by interaction with membrane proteins.
Target Tissue Specificity
Ubiquitous. Detected in brain, heart, kidney, lung, small intestine and skeletal muscle. Detected in various cell lines including HeLa. Weakly expressed in peripheral blood leukocytes.
Target Research Area
Signal Transduction
Target Synonyms
Glutaminase interacting protein 3; Glutaminase-interacting protein 3; Tax interaction protein 1; Tax1 (human T cell leukemia virus type I) binding protein 3; Tax1 binding protein 3; Tax1-binding protein 3; Tax1bp3; TIP 1; TIP-1; TIP1; TX1B3_HUMAN
Target Background
This gene encodes a small, highly conserved protein with a single PDZ domain. PDZ (PSD-95/Discs large/ZO-1 homologous) domains promote protein-protein interactions that affect cell signaling, adhesion, protein scaffolding, and receptor and ion transporter functions. The encoded protein interacts with a large number of target proteins that play roles in signaling pathways; for example, it interacts with Rho A and glutaminase L and also acts as a negative regulator of the Wnt/beta-catenin signaling pathway. This protein was first identified as binding to the T-cell leukaemia virus (HTLV1) Tax oncoprotein. Overexpression of this gene has been implicated in altered cancer cell adhesion, migration and metastasis. The encoded protein also modulates the localization and density of inwardly rectifying potassium channel 2.3 (Kir2.3). To date, this protein has been shown to play a role in cell proliferation, development, stress response, and polarization. Alternative splicing results in multiple transcript variants encoding distinct isoforms.
Notification