-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TAZ was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 14-175 of human TAZ (NP_056287.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, IF/ICC, ELISA.
The antibody against TAZ was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 14-175 of human TAZ (NP_056287.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-07868A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TAZ |
| Target Synonyms | TAZ | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 14-175 of human TAZ (NP_056287.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GQQVIHVTQDLDTDLEALFNSVMNPKPSSWRKKILPESFFKEPDSGSHSRQSSTDSSGGHPGPRLAGGAQHVRSHSSPASLQLGTGAGAAGSPAQQHAHLRQQSYDVTDELPLPPGWEMTFTATGQRYFLNHIEKITTWQDPRKAMNQPLNHMNLHPAVSST | Uniprot ID | Q9GZV5 |
Uniprot Id
Q9GZV5
Target Species
Human
Target Name
WWTR1
Target Full Name
WW domain-containing transcription regulator protein 1
Target Function
Transcriptional coactivator which acts as a downstream regulatory target in the Hippo signaling pathway that plays a pivotal role in organ size control and tumor suppression by restricting proliferation and promoting apoptosis. The core of this pathway is composed of a kinase cascade wherein STK3/MST2 and STK4/MST1, in complex with its regulatory protein SAV1, phosphorylates and activates LATS1/2 in complex with its regulatory protein MOB1, which in turn phosphorylates and inactivates YAP1 oncoprotein and WWTR1/TAZ. WWTR1 enhances PAX8 and NKX2-1/TTF1-dependent gene activation. In conjunction with YAP1, involved in the regulation of TGFB1-dependent SMAD2 and SMAD3 nuclear accumulation. Plays a key role in coupling SMADs to the transcriptional machinery such as the mediator complex. Regulates embryonic stem-cell self-renewal, promotes cell proliferation and epithelial-mesenchymal transition.
Target Subcellular Location
Nucleus. Cytoplasm. Cell membrane.
Target Tissue Specificity
Highly expressed in kidney, heart, placenta and lung. Expressed in the thyroid tissue.
Target Synonyms
DKFZP586I1419; FLJ27004; FLJ45718; OTTHUMP00000215994; OTTHUMP00000215995; OTTHUMP00000215996; OTTHUMP00000216001; TAZ; Transcriptional co activator with PDZ binding motif; Transcriptional coactivator with PDZ binding motif; Transcriptional coactivator with PDZ-binding motif; WW domain containing transcription regulator 1; WW domain containing transcription regulator protein 1; WW domain-containing transcription regulator protein 1; WWTR 1; WWTR1; WWTR1_HUMAN
Target Background
Enables transcription coactivator activity. Involved in several processes, including hippo signaling; positive regulation of cell differentiation; and regulation of signal transduction. Located in cytosol and nuclear body.
Notification