Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TBCA was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-108 of human TBCA (NP_004598.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against TBCA was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-108 of human TBCA (NP_004598.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-03396A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TBCA |
| Target Synonyms | TBCA | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, 293T, Mouse testis, OVCAR3, U-87MG | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-108 of human TBCA (NP_004598.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MADPRVRQIKIKTGVVKRLVKEKVMYEKEAKQQEEKIEKMRAEDGENYDIKKQAEILQESRMMIPDCQRRLEAAYLDLQRILENEKDLEEAEEYKEARLVLDSVKLEA | Uniprot ID | O75347 |
Uniprot Id
O75347
Target Species
Human
Target Name
TBCA
Target Full Name
Tubulin-specific chaperone A
Target Function
Tubulin-folding protein; involved in the early step of the tubulin folding pathway.
Target Subcellular Location
Cytoplasm, cytoskeleton.
Target Protein Families
TBCA family
Target Synonyms
CFA; Chaperonin cofactor A; Co chaperonin associated with a & b tubulin; Cofactor A; tbca; TBCA_HUMAN; TCP1 chaperonin cofactor A; TCP1-chaperonin cofactor A; Tubulin cofactor a; Tubulin folding cofactor A; Tubulin specific chaperone a; Tubulin-folding cofactor A; Tubulin-specific chaperone A
Target Background
The product of this gene is one of four proteins (cofactors A, D, E, and C) involved in the pathway leading to correctly folded beta-tubulin from folding intermediates. Cofactors A and D are believed to play a role in capturing and stabilizing beta-tubulin intermediates in a quasi-native confirmation. Cofactor E binds to the cofactor D/beta-tubulin complex; interaction with cofactor C then causes the release of beta-tubulin polypeptides that are committed to the native state. This gene encodes chaperonin cofactor A. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
