Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TBL1X was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human TBL1X (NP_005638.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TBL1X was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human TBL1X (NP_005638.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05273A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TBL1X |
| Target Synonyms | EBI; TBL1; CHNG8; SMAP55; TBL1X | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, BxPC-3, Mouse brain, Mouse lung | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human TBL1X (NP_005638.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LISILQKGLQYVEAEISINEDGTVFDGRPIESLSLIDAVMPDVVQTRQQAFREKLAQQQASAAAAAAAATAAATAATTTSAGVSHQNPSKNREATVNGEEN | Uniprot ID | O60907 |
Uniprot Id
O60907
Target Species
Human
Target Name
TBL1X
Target Full Name
F-box-like/WD repeat-containing protein TBL1X
Target Function
F-box-like protein involved in the recruitment of the ubiquitin/19S proteasome complex to nuclear receptor-regulated transcription units. Plays an essential role in transcription activation mediated by nuclear receptors. Probably acts as integral component of corepressor complexes that mediates the recruitment of the 19S proteasome complex, leading to the subsequent proteasomal degradation of transcription repressor complexes, thereby allowing cofactor exchange.
Target Subcellular Location
Nucleus.
Target Protein Families
WD repeat EBI family
Target Tissue Specificity
Ubiquitous.
Target Synonyms
EBI; F box like/WD repeat protein TBL1X; F-box-like/WD repeat-containing protein TBL1X; SMAP 55; SMAP55; TBL 1; TBL 1X; TBL1; TBL1X; TBL1X_HUMAN; Transducin (beta) like 1; Transducin (beta) like 1 X linked; Transducin (beta) like 1X linked; Transducin beta like 1 X linked; Transducin beta like 1X; Transducin beta like 1X protein; Transducin beta like protein 1, X linked; Transducin beta-like protein 1X; Transducin-beta-like protein 1; X-linked
Target Background
The protein encoded by this gene has sequence similarity with members of the WD40 repeat-containing protein family. The WD40 group is a large family of proteins, which appear to have a regulatory function. It is believed that the WD40 repeats mediate protein-protein interactions and members of the family are involved in signal transduction, RNA processing, gene regulation, vesicular trafficking, cytoskeletal assembly and may play a role in the control of cytotypic differentiation. This encoded protein is found as a subunit in corepressor SMRT (silencing mediator for retinoid and thyroid receptors) complex along with histone deacetylase 3 protein. This gene is located adjacent to the ocular albinism gene and it is thought to be involved in the pathogenesis of the ocular albinism with late-onset sensorineural deafness phenotype. Four transcript variants encoding two different isoforms have been found for this gene. This gene is highly similar to the Y chromosome TBL1Y gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
