-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TBP was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 160-319 of human TBP (NP_001165556.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IF/ICC, ELISA.
The antibody against TBP was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 160-319 of human TBP (NP_001165556.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IF/ICC, ELISA.
| Cat.No | ADA-00284A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TBP |
| Target Synonyms | HDL4; TBP1; GTF2D; SCA17; TFIID; GTF2D1; TBP | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat skeletal muscle | Application | ELISA, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 160-319 of human TBP (NP_001165556.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LKTIALRARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRIVLLIFVSGKVVLTGAKVRAEIYEAFENIYPILKGFRKTT | Uniprot ID | P20226 |
Uniprot Id
P20226
Target Species
Human
Target Name
TBP
Target Full Name
TATA-box-binding protein
Target Function
General transcription factor that functions at the core of the DNA-binding multiprotein factor TFIID. Binding of TFIID to the TATA box is the initial transcriptional step of the pre-initiation complex (PIC), playing a role in the activation of eukaryotic genes transcribed by RNA polymerase II. Component of a BRF2-containing transcription factor complex that regulates transcription mediated by RNA polymerase III. Component of the transcription factor SL1/TIF-IB complex, which is involved in the assembly of the PIC (pre-initiation complex) during RNA polymerase I-dependent transcription. The rate of PIC formation probably is primarily dependent on the rate of association of SL1 with the rDNA promoter. SL1 is involved in stabilization of nucleolar transcription factor 1/UBTF on rDNA.
Target Involvement
Spinocerebellar ataxia 17 (SCA17)
Target Subcellular Location
Nucleus.
Target Protein Families
TBP family
Target Tissue Specificity
Widely expressed, with levels highest in the testis and ovary.
Target Synonyms
GTF2D; GTF2D1; HDL4; MGC117320; MGC126054; MGC126055; SCA17; TATA binding factor; TATA box factor; TATA sequence binding protein; TATA sequence-binding protein; TATA-binding factor; TATA-box binding protein N-terminal domain; TATA-box factor; TATA-box-binding protein; TBP; TBP_HUMAN; TFIID; Transcription initiation factor TFIID TBP subunit
Target Background
Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. This gene encodes TBP, the TATA-binding protein. A distinctive feature of TBP is a long string of glutamines in the N-terminus. This region of the protein modulates the DNA binding activity of the C terminus, and modulation of DNA binding affects the rate of transcription complex formation and initiation of transcription. The number of CAG repeats encoding the polyglutamine tract is usually 25-42, and expansion of the number of repeats to 45-66 increases the length of the polyglutamine string and is associated with spinocerebellar ataxia 17, a neurodegenerative disorder classified as a polyglutamine disease. Two transcript variants encoding different isoforms have been found for this gene.
Notification