Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TCL1B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-128 of human TCL1B (NP_004909.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TCL1B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-128 of human TCL1B (NP_004909.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03262A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TCL1B |
| Target Synonyms | TML1; SYN-1; TCL1B | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, K-562 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-128 of human TCL1B (NP_004909.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MASEASVRLGVPPGRLWIQRPGIYEDEEGRTWVTVVVRFNPSRREWARASQGSRYEPSITVHLWQMAVHTRELLSSGQMPFSQLPAVWQLYPGRKYRAADSSFWEIADHGQIDSMEQLVLTYQPERKD | Uniprot ID | O95988 |
Uniprot Id
O95988
Target Species
Human
Target Name
TCL1B
Target Full Name
T-cell leukemia/lymphoma protein 1B
Target Function
Enhances the phosphorylation and activation of AKT1 and AKT2.
Target Protein Families
TCL1 family
Target Tissue Specificity
Expressed in a variety of tissues including placenta and testis.
Target Synonyms
TCL1B; TCL1; T-cell leukemia/lymphoma protein 1B; Oncogene TCL-1B; Oncogene TCL1B; SYN-1; Syncytiotrophoblast-specific protein; TCL1/MTCP1-like protein 1
Target Background
Enables protein kinase binding activity and protein serine/threonine kinase activator activity. Involved in positive regulation of peptidyl-serine phosphorylation and positive regulation of protein serine/threonine kinase activity. Part of protein-containing complex.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
