-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TCP1 alpha was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human TCP1 alpha (P17987) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against TCP1 alpha was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human TCP1 alpha (P17987) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-13433A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TCP1 alpha |
| Target Synonyms | CCT1; CCTa; D6S230E; CCT-alpha; TCP-1-alpha; TCP1 alpha | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Jurkat | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human TCP1 alpha (P17987). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MEGPLSVFGDRSTGETIRSQNVMAAASIANIVKSSLGPVGLDKMLVDDIGDVTITNDGATILKLLEVEHPAAKVLCELADLQDKEVGDGTTSVVIIAAEL | Uniprot ID | P17987 |
Uniprot Id
P17987
Target Species
Human
Target Name
TCP1
Target Full Name
T-complex protein 1 subunit alpha
Target Function
Component of the chaperonin-containing T-complex (TRiC), a molecular chaperone complex that assists the folding of proteins upon ATP hydrolysis. The TRiC complex mediates the folding of WRAP53/TCAB1, thereby regulating telomere maintenance. As part of the TRiC complex may play a role in the assembly of BBSome, a complex involved in ciliogenesis regulating transports vesicles to the cilia. The TRiC complex plays a role in the folding of actin and tubulin.
Target Subcellular Location
Cytoplasm, cytosol. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome.
Target Protein Families
TCP-1 chaperonin family
Target Synonyms
AI528772; c-cpn; CCT alpha; CCT; CCT-alpha; CCT1; Ccta; CCTalpha; D6S230E; MGC133746; p63; T complex 1; T complex protein 1 alpha subunit; T complex protein 1; T-complex homolog TCP1; T-complex protein 1 subunit alpha; T-complex protein 1 subunit alpha B; Tailless complex polypeptide 1; Tailless complex polypeptide 1A; Tailless complex polypeptide 1B; TCP 1 alpha; Tcp-1; TCP-1-alpha; TCP1; TCPA_HUMAN; Tp63; TRic
Target Background
The protein encoded by this gene is a molecular chaperone that is a member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two identical stacked rings, each containing eight different proteins. Unfolded polypeptides enter the central cavity of the complex and are folded in an ATP-dependent manner. The complex folds various proteins, including actin and tubulin. Alternate transcriptional splice variants of this gene, encoding different isoforms, have been characterized. In addition, three pseudogenes that appear to be derived from this gene have been found.
Notification