-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TCTN1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 130-310 of human TCTN1 (NP_001076006.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TCTN1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 130-310 of human TCTN1 (NP_001076006.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05369A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TCTN1 |
| Target Synonyms | TECT1; JBTS13; TCTN1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, HT-29, MCF7, NCI-H460 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 130-310 of human TCTN1 (NP_001076006.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | NFTANPPQRVFELVDQINPSIFCIHITNYKPALSFINPEVPDENNFDTLMKTSDGFTLNAESYVSFTTKLDIPTAAKYEYGVPLQTSDSFLRFPSSLTSSLCTDNNPAAFLVNQAVKCTRKINLEQCEEIEALSMAFYSSPEILRVPDSRKKVPITVQSIVIQSLNKTLTRREDTDVLQPT | Uniprot ID | Q2MV58 |
Uniprot Id
Q2MV58
Target Species
Human
Target Name
TCTN1
Target Full Name
Tectonic-1
Target Function
Component of the tectonic-like complex, a complex localized at the transition zone of primary cilia and acting as a barrier that prevents diffusion of transmembrane proteins between the cilia and plasma membranes. Regulator of Hedgehog (Hh), required for both activation and inhibition of the Hh pathway in the patterning of the neural tube. During neural tube development, it is required for formation of the most ventral cell types and for full Hh pathway activation. Functions in Hh signal transduction to fully activate the pathway in the presence of high Hh levels and to repress the pathway in the absence of Hh signals. Modulates Hh signal transduction downstream of SMO and RAB23.
Target Involvement
Joubert syndrome 13 (JBTS13)
Target Subcellular Location
Cytoplasm, cytoskeleton, cilium basal body. Secreted.
Target Protein Families
Tectonic family
Target Synonyms
JBTS13; TCTN1; TECT1; TECT1_HUMAN; Tectonic family member 1; Tectonic-1
Target Background
This gene encodes a member of a family of secreted and transmembrane proteins. The orthologous gene in mouse functions downstream of smoothened and rab23 to modulate hedgehog signal transduction. This protein is a component of the tectonic-like complex, which forms a barrier between the ciliary axoneme and the basal body. A mutation in this gene was found in a family with Joubert syndrome-13. Alternative splicing results in multiple transcript variants.
Notification