Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TCTP/TPT1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human TCTP/TPT1 (P13693) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IP, ELISA.
The antibody against TCTP/TPT1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human TCTP/TPT1 (P13693) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IP, ELISA.
| Cat.No | ADA-13784A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TCTP/TPT1 |
| Target Synonyms | HRF; p02; p23; TCTP; TCTP/TPT1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Rat brain, HepG2, Mouse brain, Mouse liver, Mouse thymus, Rat liver, Rat ovary | Application | ELISA, WB, IHC-P, IP |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human TCTP/TPT1 (P13693). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MIIYRDLISHDEMFSDIYKIREIADGLCLEVEGKMVSRTEGNIDDSLIGGNASAEGPEGEGTESTVITGVDIVMNHHLQETSFTKEAYKKYIKDYMKSIK | Uniprot ID | P13693 |
Uniprot Id
P13693
Target Species
Human
Target Name
TPT1
Target Full Name
Translationally-controlled tumor protein
Target Function
Involved in calcium binding and microtubule stabilization.
Target Subcellular Location
Cytoplasm.
Target Protein Families
TCTP family
Target Tissue Specificity
Found in several healthy and tumoral cells including erythrocytes, hepatocytes, macrophages, platelets, keratinocytes, erythroleukemia cells, gliomas, melanomas, hepatoblastomas, and lymphomas. It cannot be detected in kidney and renal cell carcinoma (RCC
Target Research Area
Immunology
Target Synonyms
FLJ27337; Fortilin; Histamine releasing factor; Histamine-releasing factor; HRF; Immunoglobulin E-dependent; p02; p23; TCTP; TCTP_HUMAN; tpt1; Translationally controlled tumor protein; Translationally-controlled tumor protein; Tumor protein translationally controlled 1; tumor protein; translationally-controlled 1
Target Background
This gene encodes a protein that is a regulator of cellular growth and proliferation. Its mRNA is highly structured and contains an oligopyrimidine tract (5'-TOP) in its 5' untranslated region that functions to repress its translation under quiescent conditions. The encoded protein is involved in a variety of cellular pathways, including apoptosis, protein synthesis and cell division. It binds to and stabilizes microtubules, and removal of this protein through phosphorylation is required for progression through mitotic and meiotic cell divisions. This gene is known to play a role in carcinogenesis, and is upregulated in some cancer cells. Alternative splicing results in multiple transcript variants encoding different isoforms.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
