-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TDGF1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 31-150 of human TDGF1 (NP_001167607.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against TDGF1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 31-150 of human TDGF1 (NP_001167607.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-01659A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TDGF1 |
| Target Synonyms | CR; CR-1; CRGF; CRIPTO; TDGF1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | NCCIT | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 31-150 of human TDGF1 (NP_001167607.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RDDSIWPQEEPAIRPRSSQRVPPMGIQHSKELNRTCCLNGGTCMLGSFCACPPSFYGRNCEHDVRKENCGSVPHDTWLPKKCSLCKCWHGQLRCFPQAFLPGCDGLVMDEHLVASRTPEL | Uniprot ID | P13385 |
Uniprot Id
P13385
Target Species
Human
Target Name
CRIPTO
Target Full Name
Protein Cripto
Target Function
GPI-anchored cell membrane protein involved in Nodal signaling. Cell-associated TDGF1 acts as a Nodal coreceptor in cis. Shedding of TDGF1 by TMEM8A modulates Nodal signaling by allowing soluble TDGF1 to act as a Nodal coreceptor on other cells. Could play a role in the determination of the epiblastic cells that subsequently give rise to the mesoderm.
Target Subcellular Location
Cell membrane; Lipid-anchor, GPI-anchor. Secreted.
Target Protein Families
EGF-CFC (Cripto-1/FRL1/Cryptic) family
Target Tissue Specificity
Preferentially expressed in gastric and colorectal carcinomas than in their normal counterparts. Expressed in breast and lung.
Target Research Area
Developmental Biology
Target Synonyms
CR; CRGF; Cripto 1; Cripto 1 growth factor; cripto; Cripto-1 growth factor; Cripto1 growth factor; Epidermal growth factor like cripto protein CR1; Epidermal growth factor-like cripto protein CR1; TDGF 1; TDGF1; TDGF1_HUMAN; Teratocarcinoma derived growth factor 1; Teratocarcinoma-derived growth factor 1
Target Background
This gene encodes an epidermal growth factor-related protein that contains a cripto, FRL-1, and cryptic domain. The encoded protein is an extracellular, membrane-bound signaling protein that plays an essential role in embryonic development and tumor growth. Mutations in this gene are associated with forebrain defects. Pseudogenes of this gene are found on chromosomes 2, 3, 6, 8, 19 and X. Alternate splicing results in multiple transcript variants.
Notification