-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TDP2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human TDP2 (NP_057698.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TDP2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human TDP2 (NP_057698.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-14644A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TDP2 |
| Target Synonyms | EAP2; AD022; EAPII; TTRAP; hTDP2; dJ30M3.3; P2 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human TDP2 (NP_057698.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MELGSCLEGGREAAEEEGEPEVKKRRLLCVEFASVASCDAAVAQCFLAENDWEMERALNSYFEPPVEESALERRPETISEPKTYVDLTNEETTDSTTSKISPSEDTQQENGSMFSLITWNIDGLDLNNLSERARGVCSYLALYSPDVIFLQEVIPPYYSYLKKRSSNYEIITGHEEGYFTAIMLKKSRVKLKSQEIIPFP | Uniprot ID | O95551 |
Uniprot Id
O95551
Target Species
Human
Target Name
TDP2
Target Full Name
Tyrosyl-DNA phosphodiesterase 2
Target Function
DNA repair enzyme that can remove a variety of covalent adducts from DNA through hydrolysis of a 5'-phosphodiester bond, giving rise to DNA with a free 5' phosphate. Catalyzes the hydrolysis of dead-end complexes between DNA and the topoisomerase 2 (TOP2) active site tyrosine residue. The 5'-tyrosyl DNA phosphodiesterase activity can enable the repair of TOP2-induced DNA double-strand breaks/DSBs without the need for nuclease activity, creating a 'clean' DSB with 5'-phosphate termini that are ready for ligation. Thereby, protects the transcription of many genes involved in neurological development and maintenance from the abortive activity of TOP2. Hydrolyzes 5'-phosphoglycolates on protruding 5' ends on DSBs due to DNA damage by radiation and free radicals. Has preference for single-stranded DNA or duplex DNA with a 4 base pair overhang as substrate. Acts as a regulator of ribosome biogenesis following stress. Has also 3'-tyrosyl DNA phosphodiesterase activity, but less efficiently and much slower than TDP1. Constitutes the major if not only 5'-tyrosyl-DNA phosphodiesterase in cells. Also acts as an adapter by participating in the specific activation of MAP3K7/TAK1 in response to TGF-beta: associates with components of the TGF-beta receptor-TRAF6-TAK1 signaling module and promotes their ubiquitination dependent complex formation. Involved in non-canonical TGF-beta induced signaling routes. May also act as a negative regulator of ETS1 and may inhibit NF-kappa-B activation.; (Microbial infection) Also acts as a 5'-tyrosyl-RNA phosphodiesterase following picornavirus infection: its activity is hijacked by picornavirus and acts by specifically cleaving the protein-RNA covalent linkage generated during the viral genomic RNA replication steps of a picornavirus infection, without impairing the integrity of viral RNA.
Target Involvement
Spinocerebellar ataxia, autosomal recessive, 23 (SCAR23)
Target Subcellular Location
Nucleus. Nucleus, PML body. Nucleus, nucleolus. Cytoplasm.; Cytoplasm.
Target Protein Families
CCR4/nocturin family
Target Tissue Specificity
Widely expressed. Highly expressed in various brain regions, including the frontal and occipital lobes, the hippocampus, the striatum and the cerebellum.
Target Synonyms
5'-Tyr-DNA phosphodiesterase; 5'-tyrosyl-DNA phosphodiesterase; AD 022; AD022; dJ30M3.3; EAP 2; EAP II; EAP2; EAPII; ETS 1 associated protein 2; ETS 1 associated protein II; ETS1 associated protein 2; ETS1 associated protein II; ETS1-associated protein 2; ETS1-associated protein II; MGC111021; MGC9099; RP1-30M3.3; tdp2; TRAF and TNF receptor associated protein; TRAF and TNF receptor-associated protein; TTRAP; TYDP2_HUMAN; Tyr DNA phosphodiesterase 2; Tyr-DNA phosphodiesterase 2; Tyrosyl DNA phosphodiesterase 2; Tyrosyl-DNA phosphodiesterase 2
Target Background
This gene encodes a member of a superfamily of divalent cation-dependent phosphodiesterases. The encoded protein associates with CD40, tumor necrosis factor (TNF) receptor-75 and TNF receptor associated factors (TRAFs), and inhibits nuclear factor-kappa-B activation. This protein has sequence and structural similarities with APE1 endonuclease, which is involved in both DNA repair and the activation of transcription factors.
Notification