-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TEAD1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of human TEAD1 (NP_068780.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, IP, ChIP, ELISA.
The antibody against TEAD1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of human TEAD1 (NP_068780.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, IP, ChIP, ELISA.
| Cat.No | ADA-11941A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TEAD1 |
| Target Synonyms | AA; REF1; TCF13; TEF-1; NTEF-1; TCF-13; TEAD-1; TEAD1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse heart, Rat heart, 293T, Mouse skeletal muscle | Application | ELISA, WB, ChIP, IF/ICC, IHC-P, IP |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 200-300 of human TEAD1 (NP_068780.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | APSVPAWQGRSIGTTKLRLVEFSAFLEQQRDPDSYNKHLFVHIGHANHSYSDPLLESVDIRQIYDKFPEKKGGLKELFGKGPQNAFFLVKFWADLNCNIQD | Uniprot ID | P28347 |
Uniprot Id
P28347
Target Species
Human
Target Name
TEAD1
Target Full Name
Transcriptional enhancer factor TEF-1
Target Function
Transcription factor which plays a key role in the Hippo signaling pathway, a pathway involved in organ size control and tumor suppression by restricting proliferation and promoting apoptosis. The core of this pathway is composed of a kinase cascade wherein MST1/MST2, in complex with its regulatory protein SAV1, phosphorylates and activates LATS1/2 in complex with its regulatory protein MOB1, which in turn phosphorylates and inactivates YAP1 oncoprotein and WWTR1/TAZ. Acts by mediating gene expression of YAP1 and WWTR1/TAZ, thereby regulating cell proliferation, migration and epithelial mesenchymal transition (EMT) induction. Binds specifically and cooperatively to the SPH and GT-IIC 'enhansons' (5'-GTGGAATGT-3') and activates transcription in vivo in a cell-specific manner. The activation function appears to be mediated by a limiting cell-specific transcriptional intermediary factor (TIF). Involved in cardiac development. Binds to the M-CAT motif.
Target Involvement
Sveinsson chorioretinal atrophy (SCRA)
Target Subcellular Location
Nucleus.
Target Tissue Specificity
Preferentially expressed in skeletal muscle. Lower levels in pancreas, placenta, and heart.
Target Research Area
Cardiovascular
Target Synonyms
AA; Atrophia areata peripapillary chorioretinal degeneration; NTEF 1; NTEF-1; NTEF1; Protein GT IIC; Protein GT-IIC; REF 1; REF1; SV40 transcriptional enhancer factor; TCF 13; TCF-13; TCF13; TEA domain family member; TEA domain family member 1 (SV40 transcriptional enhancer factor); TEA domain family member 1; TEAD 1; TEAD 1 protein; TEAD-1; TEAD1; TEAD1 protein; TEAD1_HUMAN; TEF 1; TEF1; Transcription factor 13 (SV40 transcriptional enhancer factor); Transcription factor 13; Transcriptional enhancer factor 1; Transcriptional enhancer factor TEF-1; Transcriptional enhancer factor TEF1
Target Background
This gene encodes a ubiquitous transcriptional enhancer factor that is a member of the TEA/ATTS domain family. This protein directs the transactivation of a wide variety of genes and, in placental cells, also acts as a transcriptional repressor. Mutations in this gene cause Sveinsson's chorioretinal atrophy. Additional transcript variants have been described but their full-length natures have not been experimentally verified.
Notification