-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TENM1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 350-540 of human TENM1 (NP_001156750.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against TENM1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 350-540 of human TENM1 (NP_001156750.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-04848A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TENM1 |
| Target Synonyms | TNM; ODZ1; ODZ3; TEN1; TNM1; ten-1; TEN-M1; TENM1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, U-251MG, U-87MG | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 350-540 of human TENM1 (NP_001156750.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QPVEGELYANGVSKGNRGTESMDTTYSPIGGKVSDKSEKKVFQKGRAIDTGEVDIGAQVMQTIPPGLFWRFQITIHHPIYLKFNISLAKDSLLGIYGRRNIPPTHTQFDFVKLMDGKQLVKQDSKGSDDTQHSPRNLILTSLQETGFIEYMDQGPWYLAFYNDGKKMEQVFVLTTAIEIMDDCSTNCNGNG | Uniprot ID | Q9UKZ4 |
Uniprot Id
Q9UKZ4
Target Species
Human
Target Name
TENM1
Target Full Name
Teneurin-1
Target Function
Involved in neural development, regulating the establishment of proper connectivity within the nervous system. May function as a cellular signal transducer.; Plays a role in the regulation of neuroplasticity in the limbic system. Mediates a rapid reorganization of actin- and tubulin-based cytoskeleton elements with an increase in dendritic arborization and spine density formation of neurons in the hippocampus and amygdala. Induces BDNF transcription inhibition in neurons. Activates the mitogen-activated protein (MAP) kinase 2 (MEK2) and extracellular signal-regulated kinase (ERK) cascade. Acts also as a bioactive neuroprotective peptide on limbic neurons of the brain and regulates stress-induced behavior: attenuates alkalosis-associated necrotic cell death and the effects of corticotropin-releasing factor (CRF) on c-fos/FOS induction and on the reinstatement of cocaine seeking.; Induces gene transcription activation.
Target Subcellular Location
Cell membrane; Single-pass membrane protein.; [Ten-1 intracellular domain]: Nucleus. Nucleus speckle. Nucleus matrix. Cytoplasm, cytoskeleton.; [Teneurin C-terminal-associated peptide]: Nucleus. Cytoplasm. Cell membrane.
Target Protein Families
Tenascin family, Teneurin subfamily
Target Tissue Specificity
Expressed in fetal brain.
Target Synonyms
TENM1; ODZ1; TNM1; Teneurin-1; Ten-1; Protein Odd Oz/ten-m homolog 1; Tenascin-M1; Ten-m1; Teneurin transmembrane protein 1) [Cleaved into: Ten-1 intracellular domain; IDten-1; Ten-1 ICD); Teneurin C-terminal-associated peptide; TCPA-1; Ten-1 extracellular domain; Ten-1 ECD)]
Target Background
The protein encoded by this gene belongs to the tenascin family and teneurin subfamily. It is expressed in the neurons and may function as a cellular signal transducer. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Notification