Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TEP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 2523-2627 of human TEP1 (NP_009041.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TEP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 2523-2627 of human TEP1 (NP_009041.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00901A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TEP1 |
| Target Synonyms | TP1; TLP1; p240; TROVE1; VAULT2; TEP1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | DU145 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 2523-2627 of human TEP1 (NP_009041.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TCRESDASMDSDASMDSEPTPHLKTRQRRKIHSGSVTALHVLPELLVTASKDRDVKLWERPSMQLLGLFRCEGSVSCLEPWLGANSTLQLAVGDVQGNVYFLNWE | Uniprot ID | Q99973 |
Uniprot Id
Q99973
Target Species
Human
Target Name
TEP1
Target Full Name
Telomerase protein component 1
Target Function
Component of the telomerase ribonucleoprotein complex that is essential for the replication of chromosome termini. Also component of the ribonucleoprotein vaults particle, a multi-subunit structure involved in nucleo-cytoplasmic transport. Responsible for the localizing and stabilizing vault RNA (vRNA) association in the vault ribonucleoprotein particle. Binds to TERC.
Target Subcellular Location
Nucleus. Chromosome, telomere.
Target Tissue Specificity
Ubiquitous.
Target Synonyms
TEP1; TLP1; TP1; Telomerase protein component 1; Telomerase-associated protein 1; Telomerase protein 1; p240; p80 telomerase homolog
Target Background
This gene product is a component of the ribonucleoprotein complex responsible for telomerase activity which catalyzes the addition of new telomeres on the chromosome ends. The telomerase-associated proteins are conserved from ciliates to humans. Alternative splicing results in multiple transcript variants.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
