Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TEX101 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 44-150 of human TEX101 (NP_113639.4) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against TEX101 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 44-150 of human TEX101 (NP_113639.4) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-06867A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TEX101 |
| Target Synonyms | SGRG; CT131; GTPR867; NYD-SP8; PRO1884; SPATA44; TES101RP; TEX101 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-549 | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 44-150 of human TEX101 (NP_113639.4). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LYCQKGLSMTVEADPANMFNWTTEEVETCDKGALCQETILIIKAGTETAILATKGCIPEGEEAITIVQHSSPPGLIVTSYSNYCEDSFCNDKDSLSQFWEFSETTAS | Uniprot ID | Q9BY14 |
Uniprot Id
Q9BY14
Target Species
Human
Target Name
TEX101
Target Full Name
Testis-expressed protein 101
Target Function
Plays a role in fertilization by controlling binding of sperm to zona pellucida and migration of spermatozoa into the oviduct. May play a role in signal transduction and promote protein tyrosine phosphorylation.
Target Subcellular Location
Cell membrane; Lipid-anchor, GPI-anchor. Membrane raft. Cytoplasmic vesicle, secretory vesicle, acrosome. Secreted. Cytoplasmic vesicle.
Target Tissue Specificity
Detected in testis and spermatogonia. Not detected in spermatocytes. Detected in blood leukocytes.
Target Synonyms
TEX101; SGRG; UNQ867/PRO1884; Testis-expressed protein 101; Cell surface receptor NYD-SP8; Scleroderma-associated autoantigen; Spermatogenesis-related gene protein
Target Background
Predicted to be involved in binding activity of sperm to zona pellucida; flagellated sperm motility; and regulation of flagellated sperm motility. Predicted to be located in acrosomal vesicle; extracellular region; and plasma membrane. Predicted to be active in plasma membrane raft. Predicted to be anchored component of plasma membrane.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
