-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TFCP2L1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 360-430 of human TFCP2L1 (NP_055368.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TFCP2L1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 360-430 of human TFCP2L1 (NP_055368.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02196A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TFCP2L1 |
| Target Synonyms | LBP9; CRTR1; LBP-9; TFCP2L1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 22Rv1, SGC-7901 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 360-430 of human TFCP2L1 (NP_055368.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | NAIKGRNVRPKMTIYVCQELEQNRVPLQQKRDGSGDSNLSVYHAIFLEELTTLELIEKIANLYSISPQHIH | Uniprot ID | Q9NZI6 |
Uniprot Id
Q9NZI6
Target Species
Human
Target Name
TFCP2L1
Target Full Name
Transcription factor CP2-like protein 1
Target Function
Transcription factor that facilitates establishment and maintenance of pluripotency in embryonic stem cells (ESCs). With KLF2, acts as the major effector of self-renewal that mediates induction of pluripotency downstream of LIF/STAT3 and Wnt/beta-catenin signaling. Required for normal duct development in the salivary gland and kidney. Coordinates the development of the kidney collecting ducts intercalated (IC) and principal (PC) cells, which regulate acid-base and salt-water homeostasis, respectively. Regulates the expression of IC genes including subunits B1 and D2 of the V-ATPase complex, OXGR1, CA12, SLC4A1, AQP6 and IC-specific transcription factor FOXI1. Regulates also the expression of JAG1 and subsequent notch signaling in the collecting duct. JAG1 initiates notch signaling in PCs but inhibits notch signaling in ICs. Acts as a transcriptional suppressor that may suppress UBP1-mediated transcriptional activation. Modulates the placental expression of CYP11A1
Target Subcellular Location
Nucleus.
Target Protein Families
Grh/CP2 family, CP2 subfamily
Target Tissue Specificity
Highly expressed in placental JEG-3 cells and very low levels of expression in non-steroidogenic cells. No expression was seen in adrenal NCI-H295A cells or in adrenal tissue.
Target Synonyms
CP2 related transcriptional repressor 1; CP2-related transcriptional repressor 1; CRTR 1; CRTR-1; LBP 9; LBP9; TF2L1_HUMAN; TFCP2 L1; TFCP2L1; Transcription factor CP2 like 1; Transcription factor CP2 like protein 1; Transcription factor CP2-like protein 1; Transcription factor LBP 9; Transcription factor LBP-9; Transcription factor LBP9
Target Background
Enables RNA polymerase II cis-regulatory region sequence-specific DNA binding activity. Involved in regulation of transcription by RNA polymerase II. Predicted to be located in cytoplasm and membrane. Predicted to be part of chromatin. Predicted to be active in nucleus.
Notification