-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TFDP2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 287-386 of human TFDP2 (NP_006277.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TFDP2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 287-386 of human TFDP2 (NP_006277.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04002A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TFDP2 |
| Target Synonyms | DP2; TFDP2 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Mouse brain | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 287-386 of human TFDP2 (NP_006277.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GYITDISTGPSWLNQGLLLNSTQSVSNLDLTTGATLPQSSVNQGLCLDAEVALATGQFLAPNSHQSSSAASHCSESRGETPCSFNDEDEEDDEEDSSSPE | Uniprot ID | Q14188 |
Uniprot Id
Q14188
Target Species
Human
Target Name
TFDP2
Target Full Name
Transcription factor Dp-2
Target Function
Can stimulate E2F-dependent transcription. Binds DNA cooperatively with E2F family members through the E2 recognition site, 5'-TTTC[CG]CGC-3', found in the promoter region of a number of genes whose products are involved in cell cycle regulation or in DNA replication. The TFDP2:E2F complex functions in the control of cell-cycle progression from G1 to S phase. The E2F1:DP complex appears to mediate both cell proliferation and apoptosis. Blocks adipocyte differentiation by repressing CEBPA binding to its target gene promoters.
Target Subcellular Location
Nucleus.
Target Protein Families
E2F/DP family
Target Tissue Specificity
High levels in heart and skeletal muscle. Also found in placenta, kidney, brain, lung and liver. The presence as well as the abundance of the different transcripts appear to vary significantly in different tissues and cell lines.
Target Synonyms
DP2; E2F dimerization partner 2; Tfdp2; TFDP2_HUMAN; Transcription factor Dp 2; Transcription factor Dp-2
Target Background
The gene is a member of the transcription factor DP family. The encoded protein forms heterodimers with the E2F transcription factors resulting in transcriptional activation of cell cycle regulated genes. Alternative splicing results in multiple transcript variants.
Notification