-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TFPI was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 29-224 of human TFPI (NP_001027452.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TFPI was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 29-224 of human TFPI (NP_001027452.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03190A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TFPI |
| Target Synonyms | EPI; TFI; LACI; TFPI1; TFPI | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | MCF7, Mouse spleen, Rat lung | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 29-224 of human TFPI (NP_001027452.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DSEEDEEHTIITDTELPPLKLMHSFCAFKADDGPCKAIMKRFFFNIFTRQCEEFIYGGCEGNQNRFESLEECKKMCTRDNANRIIKTTLQQEKPDFCFLEEDPGICRGYITRYFYNNQTKQCERFKYGGCLGNMNNFETLEECKNICEDGPNGFQVDNYGTQLNAVNNSLTPQSTKVPSLFVTKEGTNDGWKNAAH | Uniprot ID | P10646 |
Uniprot Id
P10646
Target Species
Human
Target Name
TFPI
Target Full Name
Tissue factor pathway inhibitor
Target Function
Inhibits factor X (X(a)) directly and, in a Xa-dependent way, inhibits VIIa/tissue factor activity, presumably by forming a quaternary Xa/LACI/VIIa/TF complex. It possesses an antithrombotic action and also the ability to associate with lipoproteins in plasma.
Target Subcellular Location
[Isoform Alpha]: Secreted.; [Isoform Beta]: Microsome membrane; Lipid-anchor, GPI-anchor.
Target Tissue Specificity
Mostly in endothelial cells.
Target Research Area
Cardiovascular
Target Synonyms
Anti convertin; EPI; Extrinsic pathway inhibitor; LACI; Lipoprotein associated coagulation inhibitor; Lipoprotein-associated coagulation inhibitor; TFI; TFPI 1; TFPI; TFPI1; TFPI1_HUMAN; Tissue factor pathway inhibitor (lipoprotein associated coagulation inhibitor); Tissue factor pathway inhibitor
Target Background
This gene encodes a Kunitz-type serine protease inhibitor that regulates the tissue factor (TF)-dependent pathway of blood coagulation. The coagulation process initiates with the formation of a factor VIIa-TF complex, which proteolytically activates additional proteases (factors IX and X) and ultimately leads to the formation of a fibrin clot. The product of this gene inhibits the activated factor X and VIIa-TF proteases in an autoregulatory loop. Inhibition of the encoded protein restores hemostasis in animal models of hemophilia. This gene encodes multiple protein isoforms that differ in their inhibitory activity, specificity and cellular localization.
Notification