-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TGFB1I1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 120-220 of human TGFB1I1 (NP_001035919.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TGFB1I1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 120-220 of human TGFB1I1 (NP_001035919.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01309A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TGFB1I1 |
| Target Synonyms | HIC5; ARA55; HIC-5; TSC-5; TGFB1I1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse lung, Rat lung | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 120-220 of human TGFB1I1 (NP_001035919.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VASGEQKEDQSEDKKRPSLPSSPSPGLPKASATSATLELDRLMASLSDFRVQNHLPASGPTQPPVVSSTNEGSPSPPEPTGKGSLDTMLGLLQSDLSRRGV | Uniprot ID | O43294 |
Uniprot Id
O43294
Target Species
Human
Target Name
TGFB1I1
Target Full Name
Transforming growth factor beta-1-induced transcript 1 protein
Target Function
Functions as a molecular adapter coordinating multiple protein-protein interactions at the focal adhesion complex and in the nucleus. Links various intracellular signaling modules to plasma membrane receptors and regulates the Wnt and TGFB signaling pathways. May also regulate SLC6A3 and SLC6A4 targeting to the plasma membrane hence regulating their activity. In the nucleus, functions as a nuclear receptor coactivator regulating glucocorticoid, androgen, mineralocorticoid and progesterone receptor transcriptional activity. May play a role in the processes of cell growth, proliferation, migration, differentiation and senescence. May have a zinc-dependent DNA-binding activity.
Target Subcellular Location
Cell junction, focal adhesion. Nucleus matrix. Cytoplasm, cytoskeleton. Note=Associated with the actin cytoskeleton; colocalizes with stress fibers.
Target Protein Families
Paxillin family
Target Tissue Specificity
Expressed in platelets, smooth muscle and prostate stromal cells (at protein level).
Target Synonyms
Androgen receptor coactivator 55 kDa protein; Androgen receptor coactivator ARA55; Androgen receptor-associated protein of 55 kDa; ARA55; Hic-5; Hydrogen peroxide-inducible clone 5 protein; Tgfb1i1; TGFI1_HUMAN; Transforming growth factor beta 1 induced transcript 1; Transforming growth factor beta-1-induced transcript 1 protein; TSC 5
Target Background
This gene encodes a coactivator of the androgen receptor, a transcription factor which is activated by androgen and has a key role in male sexual differentiation. The encoded protein is thought to regulate androgen receptor activity and may have a role to play in the treatment of prostate cancer. Multiple transcript variants encoding different isoforms have been found for this gene.
Notification