Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TGS1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 714-853 of human TGS1 (NP_079107.6) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TGS1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 714-853 of human TGS1 (NP_079107.6) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-09178A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TGS1 |
| Target Synonyms | PIMT; PIPMT; NCOA6IP; TGS1 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, Jurkat, MCF7, Mouse testis, Mouse thymus | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 714-853 of human TGS1 (NP_079107.6). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RVIAIDIDPVKIALARNNAEVYGIADKIEFICGDFLLLASFLKADVVFLSPPWGGPDYATAETFDIRTMMSPDGFEIFRLSKKITNNIVYFLPRNADIDQVASLAGPGGQVEIEQNFLNNKLKTITAYFGDLIRRPASET | Uniprot ID | Q96RS0 |
Uniprot Id
Q96RS0
Target Species
Human
Target Name
TGS1
Target Full Name
Trimethylguanosine synthase
Target Function
Catalyzes the 2 serial methylation steps for the conversion of the 7-monomethylguanosine (m(7)G) caps of snRNAs and snoRNAs to a 2,2,7-trimethylguanosine (m(2,2,7)G) cap structure. The enzyme is specific for guanine, and N7 methylation must precede N2 methylation. Hypermethylation of the m7G cap of U snRNAs leads to their concentration in nuclear foci, their colocalization with coilin and the formation of canonical Cajal bodies (CBs). Plays a role in transcriptional regulation.
Target Subcellular Location
Cytoplasm. Nucleus, Cajal body. Nucleus, nucleolus.
Target Protein Families
Methyltransferase superfamily, Trimethylguanosine synthase family
Target Tissue Specificity
Ubiquitously expressed. High expression in heart, skeletal muscle, kidney, liver and placenta.
Target Synonyms
Cap specific guanine N2 methyltransferase; Cap-specific guanine-N2 methyltransferase; CLL associated antigen KW 2; CLL-associated antigen KW-2; DKFZp762A163; FLJ22995; HCA137; Hepatocellular carcinoma associated antigen 137; Hepatocellular carcinoma-associated antigen 137; NCOA6IP; Nuclear receptor coactivator 6 interacting protein; Nuclear receptor coactivator 6-interacting protein; PIMT; PIPMT; PRIP interacting protein PIPMT; PRIP interacting protein with methyltransferase domain; PRIP interacting protein with methyltransferase motif; PRIP-interacting protein with methyltransferase motif; SEREX defined; TGS 1; Tgs1; TGS1_HUMAN; Trimethylguanosine synthase; Trimethylguanosine synthase homolog (S. cerevisiae); Trimethylguanosine synthase homolog
Target Background
Enables RNA trimethylguanosine synthase activity. Involved in 7-methylguanosine cap hypermethylation. Located in cytosol and nucleus.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
