Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against THBS3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 787-956 of human THBS3 (NP_009043.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against THBS3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 787-956 of human THBS3 (NP_009043.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04088A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | THBS3 |
| Target Synonyms | TSP3; THBS3 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Mouse ovary | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 787-956 of human THBS3 (NP_009043.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TDDDYAGFLFSYQDSGRFYVVMWKQTEQTYWQATPFRAVAQPGLQLKAVTSVSGPGEHLRNALWHTGHTPDQVRLLWTDPRNVGWRDKTSYRWQLLHRPQVGYIRVKLYEGPQLVADSGVIIDTSMRGGRLGVFCFSQENIIWSNLQYRCNDTVPEDFEPFRRQLLQGRV | Uniprot ID | P49746 |
Uniprot Id
P49746
Target Species
Human
Target Name
THBS3
Target Full Name
Thrombospondin-3
Target Function
Adhesive glycoprotein that mediates cell-to-cell and cell-to-matrix interactions. Can bind to fibrinogen, fibronectin, laminin and type V collagen.
Target Protein Families
Thrombospondin family
Target Synonyms
THBS3; TSP3Thrombospondin-3
Target Background
The protein encoded by this gene belongs to the thrombospondin family. Thrombospondin family members are adhesive glycoproteins that mediate cell-to-cell and cell-to-matrix interactions. This protein forms a pentameric molecule linked by a single disulfide bond. This gene shares a common promoter with metaxin 1. Alternate splicing results in coding and non-coding transcript variants.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
