-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against THEM4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 37-150 of human THEM4 (NP_444283.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against THEM4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 37-150 of human THEM4 (NP_444283.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-04727A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | THEM4 |
| Target Synonyms | CTMP; THEM4 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse brain, Mouse liver, Mouse testis, U-87MG | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 37-150 of human THEM4 (NP_444283.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SSEEVILKDCSVPNPSWNKDLRLLFDQFMKKCEDGSWKRLPSYKRTPTEWIQDFKTHFLDPKLMKEEQMSQAQLFTRSFDDGLGFEYVMFYNDIEKRMVCLFQGGPYLEGPPGF | Uniprot ID | Q5T1C6 |
Uniprot Id
Q5T1C6
Target Species
Human
Target Name
THEM4
Target Full Name
Acyl-coenzyme A thioesterase THEM4
Target Function
Has acyl-CoA thioesterase activity towards medium and long-chain (C14 to C18) fatty acyl-CoA substrates, and probably plays a role in mitochondrial fatty acid metabolism. Plays a role in the apoptotic process, possibly via its regulation of AKT1 activity. According to PubMed:11598301, inhibits AKT1 phosphorylation and activity. According to PubMed:17615157, enhances AKT1 activity by favoring its phosphorylation and translocation to plasma membrane.
Target Subcellular Location
Cell membrane. Cell projection, ruffle membrane. Cytoplasm. Mitochondrion. Mitochondrion inner membrane; Peripheral membrane protein. Mitochondrion intermembrane space.
Target Protein Families
THEM4/THEM5 thioesterase family
Target Tissue Specificity
Expressed predominantly in skeletal muscle, testis, uterus, brain and kidney. Down-regulated in glioblastoma or glioma compared to non-neoplastic brain due to promoter hypermethylation.
Target Synonyms
Acyl CoA thioesterase THEM4; Acyl coenzyme A thioesterase THEM4; C terminal modulator protein; Carboxyl-terminal modulator protein; CTMP; FLJ27206; MGC29636; OTTHUMP00000015248; Them4; THEM4_HUMAN; Thioesterase superfamily member 4
Target Background
Protein kinase B (PKB) is a major downstream target of receptor tyrosine kinases that signal via phosphatidylinositol 3-kinase. Upon cell stimulation, PKB is translocated to the plasma membrane, where it is phosphorylated in the C-terminal regulatory domain. The protein encoded by this gene negatively regulates PKB activity by inhibiting phosphorylation. Transcription of this gene is commonly downregulated in glioblastomas.
Notification