-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Thioredoxin 1 (Trx1/TXN) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 2-105 of human Trx1/Thioredoxin 1 (Trx1/TXN) (NP_003320.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against Thioredoxin 1 (Trx1/TXN) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 2-105 of human Trx1/Thioredoxin 1 (Trx1/TXN) (NP_003320.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-05450A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Thioredoxin 1 (Trx1/TXN) |
| Target Synonyms | TRX; TRDX; TRX1; Trx80; Thioredoxin 1 (Trx1/TXN) | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | H460, HepG2, HT-29, MCF7, SKOV3 | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 2-105 of human Trx1/Thioredoxin 1 (Trx1/TXN) (NP_003320.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV | Uniprot ID | P10599 |
Uniprot Id
P10599
Target Species
Human
Target Name
TXN
Target Full Name
Thioredoxin
Target Function
Participates in various redox reactions through the reversible oxidation of its active center dithiol to a disulfide and catalyzes dithiol-disulfide exchange reactions. Plays a role in the reversible S-nitrosylation of cysteine residues in target proteins, and thereby contributes to the response to intracellular nitric oxide. Nitrosylates the active site Cys of CASP3 in response to nitric oxide (NO), and thereby inhibits caspase-3 activity. Induces the FOS/JUN AP-1 DNA-binding activity in ionizing radiation (IR) cells through its oxidation/reduction status and stimulates AP-1 transcriptional activity.; ADF augments the expression of the interleukin-2 receptor TAC (IL2R/P55).
Target Subcellular Location
Nucleus. Cytoplasm. Secreted.
Target Protein Families
Thioredoxin family
Target Research Area
Transport
Target Synonyms
ADF; ATL derived factor; ATL-derived factor; DKFZp686B1993; MGC61975; SASP; Surface associated sulphydryl protein; Surface-associated sulphydryl protein; testicular tissue protein Li 199; THIO_HUMAN; Thioredoxin; thioredoxin delta 3; TRDX; TRX 1; Trx; TRX1; TXN; TXN delta 3; TXN protein; zgc:92903
Target Background
The protein encoded by this gene acts as a homodimer and is involved in many redox reactions. The encoded protein is active in the reversible S-nitrosylation of cysteines in certain proteins, which is part of the response to intracellular nitric oxide. This protein is found in the cytoplasm. Two transcript variants encoding different isoforms have been found for this gene.
Notification