-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Thioredoxin reductase 2 (TXNRD2 ) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Thioredoxin reductase 2 (TXNRD2 ) (NP_006431.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Thioredoxin reductase 2 (TXNRD2 ) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Thioredoxin reductase 2 (TXNRD2 ) (NP_006431.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-16123A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Thioredoxin reductase 2 (TXNRD2 ) |
| Target Synonyms | TR; TR3; SELZ; GCCD5; TRXR2; TR-BETA; Thioredoxin reductase 2 (TXNRD2 ) | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse kidney, 293T, Mouse liver, Mouse spleen | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Thioredoxin reductase 2 (TXNRD2 ) (NP_006431.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAAMAVALRGLGGRFRWRTQAVAGGVRGAARGAAAGQRDYDLLVVGGGSGGLACAKEAAQLGRKVAVVDYVEPSPQGTRWGLGGTCVNVGCIPKKLMHQA | Uniprot ID | Q9NNW7 |
Uniprot Id
Q9NNW7
Target Species
Human
Target Name
TXNRD2
Target Full Name
Thioredoxin reductase 2, mitochondrial
Target Function
Involved in the control of reactive oxygen species levels and the regulation of mitochondrial redox homeostasis. Maintains thioredoxin in a reduced state. May play a role in redox-regulated cell signaling.
Target Subcellular Location
Mitochondrion.
Target Protein Families
Class-I pyridine nucleotide-disulfide oxidoreductase family
Target Tissue Specificity
Highly expressed in the prostate, ovary, liver, testis, uterus, colon and small intestine. Intermediate levels in brain, skeletal muscle, heart and spleen. Low levels in placenta, pancreas, thymus and peripheral blood leukocytes. According to PubMed:10608
Target Research Area
Others
Target Synonyms
mitochondrial; Selenoprotein Z; SelZ; Thioredoxin reductase 2; Thioredoxin reductase 2 mitochondrial; Thioredoxin reductase 3; Thioredoxin reductase beta; Thioredoxin reductase TR3; TR 3; TR; TR beta; TR-beta; TR3; TRXR 2; TRXR2; TRXR2_HUMAN; TXNRD 2; Txnrd2
Target Background
The protein encoded by this gene belongs to the pyridine nucleotide-disulfide oxidoreductase family, and is a member of the thioredoxin (Trx) system. Three thioredoxin reductase (TrxR) isozymes are found in mammals. TrxRs are selenocysteine-containing flavoenzymes, which reduce thioredoxins, as well as other substrates, and play a key role in redox homoeostasis. This gene encodes a mitochondrial form important for scavenging reactive oxygen species in mitochondria. It functions as a homodimer containing FAD, and selenocysteine (Sec) at the active site. Sec is encoded by UGA codon that normally signals translation termination. The 3' UTRs of selenoprotein mRNAs contain a conserved stem-loop structure, the Sec insertion sequence (SECIS) element, which is necessary for the recognition of UGA as a Sec codon rather than as a stop signal. Alternatively spliced transcript variants encoding different isoforms, including a few localized in the cytosol and some lacking the C-terminal Sec residue, have been found for this gene.
Notification