-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against THRA was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 138-180 of human THRA (NP_003241.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against THRA was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 138-180 of human THRA (NP_003241.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-03741A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | THRA |
| Target Synonyms | AR7; EAR7; ERBA; CHNG6; ERBA1; NR1A1; THRA1; THRA2; c-erbA; ERB-T-1; TRalpha; THRalpha; TRalpha1; TRalpha2; c-ERBA-1; THRalpha1; THRalpha2; THRA | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | SH-SY5Y | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 138-180 of human THRA (NP_003241.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | IEQNRERRRKEEMIRSLQQRPEPTPEEWDLIHIATEAHRSTNA | Uniprot ID | P10827 |
Uniprot Id
P10827
Target Species
Human
Target Name
THRA
Target Full Name
Thyroid hormone receptor alpha
Target Function
Nuclear hormone receptor that can act as a repressor or activator of transcription. High affinity receptor for thyroid hormones, including triiodothyronine and thyroxine.; Does not bind thyroid hormone and functions as a weak dominant negative inhibitor of thyroid hormone action.
Target Involvement
Hypothyroidism, congenital, non-goitrous, 6 (CHNG6)
Target Subcellular Location
Nucleus.; [Isoform Alpha-2]: Cytoplasm. Nucleus.
Target Protein Families
Nuclear hormone receptor family, NR1 subfamily
Target Research Area
Neuroscience
Target Synonyms
c-erbA-1; C-erbA-alpha; EAR-7; ERBA 1; ERBA; ERBA related 7; Nuclear receptor subfamily 1 group A member 1; THA_HUMAN; THRA; Thra1; Thra2; Thyroid hormone receptor alpha 1; Thyroid hormone receptor alpha 2; Thyroid hormone receptor alpha; TR alpha 1; TR alpha 2; Tra1; Triiodothyronine receptor; V-erbA-related protein 7
Target Background
The protein encoded by this gene is a nuclear hormone receptor for triiodothyronine. It is one of the several receptors for thyroid hormone, and has been shown to mediate the biological activities of thyroid hormone. Knockout studies in mice suggest that the different receptors, while having certain extent of redundancy, may mediate different functions of thyroid hormone. Alternatively spliced transcript variants encoding distinct isoforms have been reported.
Notification