-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TIGIT was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 167-244 of human TIGIT (NP_776160.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TIGIT was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 167-244 of human TIGIT (NP_776160.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07442A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TIGIT |
| Target Synonyms | VSIG9; VSTM3; WUCAM; TIGIT | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Human plasma, Mouse lung | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 167-244 of human TIGIT (NP_776160.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | KKALRIHSVEGDLRRKSAGQEEWSPSAPSPPGSCVQAEAAPAGLCGEQRGEDCAELHDYFNVLSYRSLGNCSFFTETG | Uniprot ID | Q495A1 |
Uniprot Id
Q495A1
Target Species
Human
Target Name
TIGIT
Target Full Name
T-cell immunoreceptor with Ig and ITIM domains
Target Function
Binds with high affinity to the poliovirus receptor (PVR) which causes increased secretion of IL10 and decreased secretion of IL12B and suppresses T-cell activation by promoting the generation of mature immunoregulatory dendritic cells.
Target Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Target Tissue Specificity
Expressed at low levels on peripheral memory and regulatory CD4+ T-cells and NK cells and is up-regulated following activation of these cells (at protein level).
Target Research Area
Immunology
Target Synonyms
DKFZp667A205; ENSMUSG00000071552; FLJ39873; RGD1563191; T cell immunoreceptor with Ig and ITIM domains; TIGIT; TIGIT_HUMAN; V-set and immunoglobulin domain containing 9; V-set and immunoglobulin domain-containing protein 9; V-set and transmembrane domain containing 3; V-set and transmembrane domain-containing protein 3; VSIG9; VSTM3; Washington University cell adhesion molecule; WUCAM
Target Background
This gene encodes a member of the PVR (poliovirus receptor) family of immunoglobin proteins. The product of this gene is expressed on several classes of T cells including follicular B helper T cells (TFH). The protein has been shown to bind PVR with high affinity; this binding is thought to assist interactions between TFH and dendritic cells to regulate T cell dependent B cell responses.
Notification