Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TIMD4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 25-130 of human TIMD4 (NP_612388.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TIMD4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 25-130 of human TIMD4 (NP_612388.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07109A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TIMD4 |
| Target Synonyms | TIM4; SMUCKLER; TIMD4 | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat spleen, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 25-130 of human TIMD4 (NP_612388.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ETVVTEVLGHRVTLPCLYSSWSHNSNSMCWGKDQCPYSGCKEALIRTDGMRVTSRKSAKYRLQGTIPRGDVSLTILNPSESDSGVYCCRIEVPGWFNDVKINVRLN | Uniprot ID | Q96H15 |
Uniprot Id
Q96H15
Target Species
Human
Target Name
TIMD4
Target Full Name
T-cell immunoglobulin and mucin domain-containing protein 4
Target Function
Phosphatidylserine receptor that enhances the engulfment of apoptotic cells. Involved in regulating T-cell proliferation and lymphotoxin signaling. Ligand for HAVCR1/TIMD1.
Target Subcellular Location
Membrane; Single-pass type I membrane protein.
Target Protein Families
Immunoglobulin superfamily, TIM family
Target Research Area
Immunology
Target Synonyms
SMUCKLER; Spleen; mucin-containing; knockout of lymphotoxin protein; T cell immunoglobulin and mucin domain containing protein 4; T-cell immunoglobulin and mucin domain containing 4; T-cell immunoglobulin and mucin domain containing molecule; T-cell immunoglobulin and mucin domain-containing protein 4; T-cell immunoglobulin and mucin domains-containing protein 4; T-cell membrane protein 4; TIM-4; Tim4; TIMD 4; TIMD-4; Timd4; TIMD4_HUMAN
Target Background
Predicted to enable phosphatidylserine binding activity. Predicted to act upstream of or within apoptotic cell clearance. Predicted to be integral component of membrane.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
