-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TIMM13 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-95 of human TIMM13 (NP_036590.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against TIMM13 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-95 of human TIMM13 (NP_036590.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-15699A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TIMM13 |
| Target Synonyms | TWIST1; ACS3; BPES2; BPES3; CRS; CRS1; CSO; SCS; TWIST; bHLHa38; twist-related protein 1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, 293T | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-95 of human TIMM13 (NP_036590.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MEGGFGSDFGGSGSGKLDPGLIMEQVKVQIAVANAQELLQRMTDKCFRKCIGKPGGSLDNSEQKCIAMCMDRYMDAWNTVSRAYNSRLQRERANM | Uniprot ID | Q9Y5L4 |
Uniprot Id
Q9Y5L4
Target Species
Human
Target Name
TIMM13
Target Full Name
Mitochondrial import inner membrane translocase subunit Tim13
Target Function
Mitochondrial intermembrane chaperone that participates in the import and insertion of some multi-pass transmembrane proteins into the mitochondrial inner membrane. Also required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space. The TIMM8-TIMM13 complex mediates the import of proteins such as TIMM23, SLC25A12/ARALAR1 and SLC25A13/ARALAR2, while the predominant TIMM9-TIMM10 70 kDa complex mediates the import of much more proteins.
Target Subcellular Location
Mitochondrion inner membrane; Peripheral membrane protein; Intermembrane side.
Target Protein Families
Small Tim family
Target Tissue Specificity
Ubiquitous, with highest expression in heart, kidney, liver and skeletal muscle.
Target Synonyms
Mitochondrial import inner membrane translocase subunit TIM13; Mitochondrial import inner membrane translocase subunit Tim13B; ppv1; TIM 13; TIM13; TIM13_HUMAN; TIM13B; TIMM 13; Timm13; TIMM13A; TIMM13B; Translocase of inner mitochondrial membrane 13 homolog
Target Background
This gene encodes a member of the evolutionarily conserved TIMM (translocase of inner mitochondrial membrane) family of proteins that function as chaperones in the import of proteins from the cytoplasm into the mitochondrial inner membrane. Proteins of this family play a role in collecting substrate proteins from the translocase of the outer mitochondrial membrane (TOM) complex and delivering them to either the sorting and assembly machinery in the outer mitochondrial membrane (SAM) complex or the TIMM22 complex in the inner mitochondrial membrane. The encoded protein and the translocase of mitochondrial inner membrane 8a protein form a 70 kDa complex in the intermembrane space.
Notification