-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TIMP3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 110-210 of human TIMP3 (NP_000353.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TIMP3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 110-210 of human TIMP3 (NP_000353.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-10996A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TIMP3 |
| Target Synonyms | SFD; K222; K222TA2; HSMRK222; TIMP3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat kidney | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 110-210 of human TIMP3 (NP_000353.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DGKMYTGLCNFVERWDQLTLSQRKGLNYRYHLGCNCKIKSCYYLPCFVTSKNECLWTDMLSNFGYPGYQSKHYACIRQKGGYCSWYRGWAPPDKSIINATD | Uniprot ID | P35625 |
Uniprot Id
P35625
Target Species
Human
Target Name
TIMP3
Target Full Name
Metalloproteinase inhibitor 3
Target Function
Complexes with metalloproteinases (such as collagenases) and irreversibly inactivates them by binding to their catalytic zinc cofactor. May form part of a tissue-specific acute response to remodeling stimuli. Known to act on MMP-1, MMP-2, MMP-3, MMP-7, MMP-9, MMP-13, MMP-14 and MMP-15.
Target Involvement
Sorsby fundus dystrophy (SFD)
Target Subcellular Location
Secreted, extracellular space, extracellular matrix.
Target Protein Families
Protease inhibitor I35 (TIMP) family
Target Research Area
Neuroscience
Target Synonyms
HSMRK222; K222; K222TA2; Metalloproteinase inhibitor 3; MIG 5 protein; MIG5 protein ; Protein MIG 5; Protein MIG-5; SFD; Sorsby fundus dystrophy pseudoinflammatory; TIMP 3; TIMP metallopeptidase inhibitor 3; TIMP-3; TIMP3; TIMP3_HUMAN; Tissue Inhibitor of Metalloproteinase 3; Tissue inhibitor of metalloproteinases 3; Tissue inhibitor of metalloproteinases3
Target Background
This gene belongs to the TIMP gene family. The proteins encoded by this gene family are inhibitors of the matrix metalloproteinases, a group of peptidases involved in degradation of the extracellular matrix (ECM). Expression of this gene is induced in response to mitogenic stimulation and this netrin domain-containing protein is localized to the ECM. Mutations in this gene have been associated with the autosomal dominant disorder Sorsby's fundus dystrophy.
Notification