Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TIMP4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 30-224 of human TIMP4 (NP_003247.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against TIMP4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 30-224 of human TIMP4 (NP_003247.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
Western blot analysis of various lysates, using TIMP4 Rabbit pAb at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 20s.
| Cat.No | ADA-09486A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TIMP4 |
| Target Synonyms | TIMP-4; TIMP4 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse heart, Rat brain, A549, Mouse ovary, U-87 MG | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 30-224 of human TIMP4 (NP_003247.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | CSCAPAHPQQHICHSALVIRAKISSEKVVPASADPADTEKMLRYEIKQIKMFKGFEKVKDVQYIYTPFDSSLCGVKLEANSQKQYLLTGQVLSDGKVFIHLCNYIEPWEDLSLVQRESLNHHYHLNCGCQITTCYTVPCTISAPNECLWTDWLLERKLYGYQAQHYVCMKHVDGTCSWYRGHLPLRKEFVDIVQP | Uniprot ID | Q99727 |
Uniprot Id
Q99727
Target Species
Human
Target Name
TIMP4
Target Full Name
Metalloproteinase inhibitor 4
Target Function
Complexes with metalloproteinases (such as collagenases) and irreversibly inactivates them by binding to their catalytic zinc cofactor. Known to act on MMP-1, MMP-2, MMP-3, MMP-7 and MMP-9.
Target Subcellular Location
Secreted.
Target Protein Families
Protease inhibitor I35 (TIMP) family
Target Tissue Specificity
Abundant in heart and present at low levels in many other tissues.
Target Research Area
Cancer, Cardiovascular
Target Synonyms
Metalloproteinase inhibitor 4; TIMP 4; TIMP metallopeptidase inhibitor 4; TIMP-4; Timp4; TIMP4_HUMAN; Tissue inhibitor of metalloproteinase 4; Tissue inhibitor of metalloproteinases 4
Target Background
This gene belongs to the TIMP gene family. The proteins encoded by this gene family are inhibitors of the matrix metalloproteinases, a group of peptidases involved in degradation of the extracellular matrix. The secreted, netrin domain-containing protein encoded by this gene is involved in regulation of platelet aggregation and recruitment and may play role in hormonal regulation and endometrial tissue remodeling.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
