Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TKTL1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 220-340 of human TKTL1 (NP_036385.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TKTL1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 220-340 of human TKTL1 (NP_036385.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05128A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TKTL1 |
| Target Synonyms | TKR; TKT2; TKTL1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, A-549, BxPC-3, LO2, Mouse testis, Rat testis | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 220-340 of human TKTL1 (NP_036385.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RGTPSIEDAESWHAKPMPRERADAIIKLIESQIQTSRNLDPQPPIEDSPEVNITDVRMTSPPDYRVGDKIATRKACGLALAKLGYANNRVVVLDGDTRYSTFSEIFNKEYPERFIECFMAE | Uniprot ID | P51854 |
Uniprot Id
P51854
Target Species
Human
Target Name
TKTL1
Target Full Name
Transketolase-like protein 1
Target Function
Catalyzes the transfer of a two-carbon ketol group from a ketose donor to an aldose acceptor, via a covalent intermediate with the cofactor thiamine pyrophosphate.
Target Subcellular Location
Cytoplasm. Nucleus. Note=Predominantly cytoplasmic and to a lesser extent also nuclear (PubMed:16969476).
Target Protein Families
Transketolase family
Target Tissue Specificity
Expressed in fetal and adult heart, brain, lung, liver, and kidney, and in adult placenta, skeletal muscle and pancreas. Up-regulated in various epithelial tumors.
Target Synonyms
TK 2; TK2; TKR; TKT 2; TKT2; TKTL1; TKTL1_HUMAN; Transketolase 2; Transketolase like 1; Transketolase like protein 1; Transketolase related protein; transketolase-like 1; Transketolase-like protein 1; Transketolase-related protein; Transketolase2
Target Background
The protein encoded by this gene is a transketolase that acts as a homodimer and catalyzes the conversion of sedoheptulose 7-phosphate and D-glyceraldehyde 3-phosphate to D-ribose 5-phosphate and D-xylulose 5-phosphate. This reaction links the pentose phosphate pathway with the glycolytic pathway. Variations in this gene may be the cause of Wernicke-Korsakoff syndrome. Three transcript variants encoding different isoforms have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
