-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TLK1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 160-230 of human TLK1 (NP_036422.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against TLK1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 160-230 of human TLK1 (NP_036422.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-05429A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TLK1 |
| Target Synonyms | PKU-beta; TLK1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | NIH/3T3, Jurkat | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 160-230 of human TLK1 (NP_036422.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PVRGIPPAIRSPQNSHSHSTPSSSVRPNSPSPTALAFGDHPIVQPKQLSFKIIQTDLTMLKLAALESNKIQ | Uniprot ID | Q9UKI8 |
Uniprot Id
Q9UKI8
Target Species
Human
Target Name
TLK1
Target Full Name
Serine/threonine-protein kinase tousled-like 1
Target Function
Rapidly and transiently inhibited by phosphorylation following the generation of DNA double-stranded breaks during S-phase. This is cell cycle checkpoint and ATM-pathway dependent and appears to regulate processes involved in chromatin assembly. Isoform 3 phosphorylates and enhances the stability of the t-SNARE SNAP23, augmenting its assembly with syntaxin. Isoform 3 protects the cells from the ionizing radiation by facilitating the repair of DSBs. In vitro, phosphorylates histone H3 at 'Ser-10'.
Target Subcellular Location
Nucleus.
Target Protein Families
Protein kinase superfamily, Ser/Thr protein kinase family
Target Tissue Specificity
Widely expressed. Present in fetal placenta, liver, kidney and pancreas but not heart or skeletal muscle. Also found in adult cell lines. Isoform 3 is ubiquitously expressed in all tissues examined.
Target Synonyms
PKU beta; PKU-beta; serine threonine protein kinase; Serine/threonine protein kinase tousled like 1; Serine/threonine-protein kinase tousled-like 1; SNARE protein kinase SNAK; Tlk1; TLK1_HUMAN; Tousled like kinase 1; Tousled-like kinase 1
Target Background
The protein encoded by this gene is a serine/threonine kinase that may be involved in the regulation of chromatin assembly. The encoded protein is only active when it is phosphorylated, and this phosphorylation is cell cycle-dependent, with the maximal activity of this protein coming during S phase. The catalytic activity of this protein is diminished by DNA damage and by blockage of DNA replication. Three transcript variants encoding different isoforms have been found for this gene.
Notification