-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TLR5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 258-404 of human TLR5 (O60602) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TLR5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 258-404 of human TLR5 (O60602) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-13990A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TLR5 |
| Target Synonyms | SLE1; TIL3; SLEB1; MELIOS; TLR5 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, A549, Mouse lung | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 258-404 of human TLR5 (O60602). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LILAHHIMGAGFGFHNIKDPDQNTFAGLARSSVRHLDLSHGFVFSLNSRVFETLKDLKVLNLAYNKINKIADEAFYGLDNLQVLNLSYNLLGELYSSNFYGLPKVAYIDLQKNHIAIIQDQTFKFLEKLQTLDLRDNALTTIHFIPS | Uniprot ID | O60602 |
Uniprot Id
O60602
Target Species
Human
Target Name
TLR5
Target Full Name
Toll-like receptor 5
Target Function
Pattern recognition receptor (PRR) located on the cell surface that participates in the activation of innate immunity and inflammatory response. Recognizes small molecular motifs named pathogen-associated molecular pattern (PAMPs) expressed by pathogens and microbe-associated molecular patterns (MAMPs) usually expressed by resident microbiota. Upon ligand binding such as bacterial flagellins, recruits intracellular adapter proteins MYD88 and TRIF leading to NF-kappa-B activation, cytokine secretion and induction of the inflammatory response. Plays thereby an important role in the relationship between the intestinal epithelium and enteric microbes and contributes to the gut microbiota composition throughout life.
Target Involvement
Systemic lupus erythematosus 1 (SLEB1)
Target Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Target Protein Families
Toll-like receptor family
Target Tissue Specificity
Highly expressed on the basolateral surface of intestinal epithelia. Expressed also in other cells such as lung epithelial cells.
Target Synonyms
FLJ10052; MGC126430; MGC126431; SLEB1; TIL 3; TIL3; TLR 5; Tlr5; TLR5_HUMAN; Toll like receptor 5; Toll like receptor 5 precursor; Toll-like receptor 5; Toll/interleukin 1 receptor like protein 3; Toll/interleukin-1 receptor-like protein 3
Target Background
This gene encodes a member of the toll-like receptor (TLR) family, which plays a fundamental role in pathogen recognition and activation of innate immune responses. These receptors recognize distinct pathogen-associated molecular patterns that are expressed on infectious agents. The protein encoded by this gene recognizes bacterial flagellin, the principal component of bacterial flagella and a virulence factor. The activation of this receptor mobilizes the nuclear factor NF-kappaB, which in turn activates a host of inflammatory-related target genes. Mutations in this gene have been associated with both resistance and susceptibility to systemic lupus erythematosus, and susceptibility to Legionnaire disease.
Notification