Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TLR8 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 849-1041 of human TLR8 (NP_619542.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against TLR8 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 849-1041 of human TLR8 (NP_619542.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-05391A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TLR8 |
| Target Synonyms | CD288; IMD98; hTLR8; TLR8 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HepG2 | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 849-1041 of human TLR8 (NP_619542.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | HHLFYWDVWFIYNVCLAKVKGYRSLSTSQTFYDAYISYDTKDASVTDWVINELRYHLEESRDKNVLLCLEERDWDPGLAIIDNLMQSINQSKKTVFVLTKKYAKSWNFKTAFYLALQRLMDENMDVIIFILLEPVLQHSQYLRLRQRICKSSILQWPDNPKAEGLFWQTLRNVVLTENDSRYNNMYVDSIKQY | Uniprot ID | Q9NR97 |
Uniprot Id
Q9NR97
Target Species
Human
Target Name
TLR8
Target Full Name
Toll-like receptor 8
Target Function
Endosomal receptor that plays a key role in innate and adaptive immunity. Controls host immune response against pathogens through recognition of RNA degradation products specific to microorganisms that are initially processed by RNASET2. Recognizes GU-rich single-stranded RNA (GU-rich RNA) derived from SARS-CoV-2, SARS-CoV-1 and HIV-1 viruses. Upon binding to agonists, undergoes dimerization that brings TIR domains from the two molecules into direct contact, leading to the recruitment of TIR-containing downstream adapter MYD88 through homotypic interaction. In turn, the Myddosome signaling complex is formed involving IRAK4, IRAK1, TRAF6, TRAF3 leading to activation of downstream transcription factors NF-kappa-B and IRF7 to induce proinflammatory cytokines and interferons, respectively.
Target Subcellular Location
Endosome membrane; Single-pass type I membrane protein.
Target Protein Families
Toll-like receptor family
Target Tissue Specificity
Expressed in myeloid dendritic cells, monocytes, and monocyte-derived dendritic cells.
Target Research Area
Immunology
Target Synonyms
CD 288; CD288; CD288 antigen; MGC119599; MGC119600; TLR 8; Tlr8; TLR8_HUMAN; Toll like receptor 8; Toll-like receptor 8
Target Background
The protein encoded by this gene is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and functional similarities. They recognize pathogen-associated molecular patterns (PAMPs) that are expressed on infectious agents, and mediate the production of cytokines necessary for the development of effective immunity. The various TLRs exhibit different patterns of expression. This gene is predominantly expressed in lung and peripheral blood leukocytes, and lies in close proximity to another family member, TLR7, on chromosome X.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
