Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TLX1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-190 of human TLX1 (NP_001182446.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TLX1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-190 of human TLX1 (NP_001182446.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03292A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TLX1 |
| Target Synonyms | TCL3; HOX11; TLX1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Jurkat, K562, Mouse spleen, Rat spleen | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-190 of human TLX1 (NP_001182446.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MEHLGPHHLHPGHAEPISFGIDQILNSPDQGGCMGPASRLQDGEYGLGCLVGGAYTYGGGGSAAATGAGGAGAYGTGGPGGPGGPAGGGGACSMGPLTGSYNVNMALAGGPGPGGGGGSSGGAGALSAAGVIRVPAHRPLAGAVAHPQPLATGLPTVPSVPAMPGVNNLTGLTFPWMESNRRYTKDRFTG | Uniprot ID | P31314 |
Uniprot Id
P31314
Target Species
Human
Target Name
TLX1
Target Full Name
T-cell leukemia homeobox protein 1
Target Function
Controls the genesis of the spleen. Binds to the DNA sequence 5'-GGCGGTAAGTGG-3'.
Target Involvement
A chromosomal aberration involving TLX1 may be a cause of a form of T-cell acute lymphoblastic leukemia (T-ALL). Translocation t(10;14)(q24;q11) with TCRD.
Target Subcellular Location
Nucleus.
Target Synonyms
Homeo box 11 (T cell leukemia 3 associated breakpoint homologous to Drosophila Notch); Homeo box 11 (T cell lymphoma 3 associated breakpoint); Homeobox 11; Homeobox protein Hox 11; Homeobox protein Hox-11; Homeobox TLX-1; Hox-11; Hox11; MGC163402; OTTHUMP00000020816; Proto oncogene TCL 3; Proto-oncogene TCL-3; RGD1563655; T cell leukemia homeobox protein 1; T cell leukemia lymphoma protein 3; T-all, included; T-cell acute lymphocytic leukemia, included; T-cell leukemia 3 gene; T-cell leukemia homeobox protein 1; T-cell leukemia, homeobox 1; T-cell leukemia/lymphoma protein 3; TCL 3 proto oncogene; TCL3; Tlx-1; TLX1; TLX1_HUMAN
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
