Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TM2D1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 38-207 of human TM2D1 (NP_114416.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TM2D1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 38-207 of human TM2D1 (NP_114416.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01916A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TM2D1 |
| Target Synonyms | BBP; TM2D1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse kidney, Rat brain, NCI-H460 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 38-207 of human TM2D1 (NP_114416.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TSAGGEESLKCEDLKVGQYICKDPKINDATQEPVNCTNYTAHVSCFPAPNITCKDSSGNETHFTGNEVGFFKPISCRNVNGYSYKVAVALSLFLGWLGADRFYLGYPALGLLKFCTVGFCGIGSLIDFILISMQIVGPSDGSSYIIDYYGTRLTRLSITNETFRKTQLYP | Uniprot ID | Q9BX74 |
Uniprot Id
Q9BX74
Target Species
Human
Target Name
TM2D1
Target Full Name
TM2 domain-containing protein 1
Target Function
May participate in amyloid-beta-induced apoptosis via its interaction with beta-APP42.
Target Subcellular Location
Membrane; Multi-pass membrane protein.
Target Protein Families
TM2 family
Target Tissue Specificity
Widely expressed.
Target Synonyms
TM2D1; BBP; TM2 domain-containing protein 1; Amyloid-beta-binding protein; hBBP
Target Background
The protein encoded by this gene is a beta-amyloid peptide-binding protein. It contains a structural module related to that of the seven transmembrane domain G protein-coupled receptor superfamily and known to be important in heterotrimeric G protein activation. Beta-amyloid peptide has been established to be a causative factor in neuron death and the consequent diminution of cognitive abilities observed in Alzheimer's disease. This protein may be a target of neurotoxic beta-amyloid peptide, and may mediate cellular vulnerability to beta-amyloid peptide toxicity through a G protein-regulated program of cell death. Several transcript variants have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
