Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TM4SF19 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human TM4SF19 (NP_001191827.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against TM4SF19 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human TM4SF19 (NP_001191827.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-10612A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TM4SF19 |
| Target Synonyms | OCTM4; TM4SF19 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse bone, Mouse spleen, Mouse testis | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 50-150 of human TM4SF19 (NP_001191827.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LLGRHAMLGTGLWGGGLMVLTALLSGGLALLGALICFVTSGVALKDGPFCMFDVSSFNQTQAWKYGYPFKDLHSRNYLYDRSLWNSVCLEPSAAVVWHVSL | Uniprot ID | Q96DZ7 |
Uniprot Id
Q96DZ7
Target Species
Human
Target Name
TM4SF19
Target Full Name
Transmembrane 4 L6 family member 19
Target Subcellular Location
Membrane; Multi-pass membrane protein.
Target Protein Families
L6 tetraspanin family
Target Synonyms
TM4SF19; OCTM4; Transmembrane 4 L6 family member 19; Osteoclast maturation-associated gene 4 protein; Tetraspan membrane protein OCTM4
Target Background
The protein encoded by this gene is a member of the four-transmembrane L6 superfamily. Members of this family function in various cellular processes including cell proliferation, motility, and adhesion via their interactions with integrins. In human brain tissue, this gene is expressed at high levels in the parietal lobe, occipital lobe, hippocampus, pons, white matter, corpus callosum, and cerebellum. Alternative splicing results in multiple transcript variants encoding different isoforms.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
