Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TM7SF2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 160-250 of human TM7SF2 (NP_003264.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TM7SF2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 160-250 of human TM7SF2 (NP_003264.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06929A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TM7SF2 |
| Target Synonyms | ANG1; C14SR; NET47; DHCR14A; TM7SF2 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse uterus | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 160-250 of human TM7SF2 (NP_003264.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LAPGGNSGNPIYDFFLGRELNPRICFFDFKYFCELRPGLIGWVLINLALLMKEAELRGSPSLAMWLVNGFQLLYVGDALWHEEAVLTTMDI | Uniprot ID | O76062 |
Uniprot Id
O76062
Target Species
Human
Target Name
TM7SF2
Target Full Name
Delta(14)-sterol reductase TM7SF2
Target Function
Catalyzes the reduction of the C14-unsaturated bond of lanosterol, as part of the metabolic pathway leading to cholesterol biosynthesis.
Target Subcellular Location
Microsome membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein.
Target Protein Families
ERG4/ERG24 family
Target Tissue Specificity
Expressed in adult heart, brain, pancreas, lung, liver, skeletal muscle, kidney, ovary, prostate, testis and adrenal gland, but not detected in placenta, spleen, thymus, small intestine, colon (mucosal lining), or peripheral blood leukocytes.
Target Synonyms
TM7SF2; ANG1; Delta(14-sterol reductase TM7SF2; Delta-14-SR; 3-beta-hydroxysterol Delta; 14-reductase; Another new gene 1 protein; C-14 sterol reductase; C14SR; Putative sterol reductase SR-1; Sterol C14-reductase; Transmembrane 7 superfamily member 2
Target Background
Enables delta14-sterol reductase activity. Involved in cholesterol biosynthetic process. Located in endoplasmic reticulum. Part of receptor complex.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
