Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TMBIM1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human TMBIM1 (NP_071435.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against TMBIM1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human TMBIM1 (NP_071435.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-10487A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TMBIM1 |
| Target Synonyms | LFG3; RECS1; MST100; PP1201; MSTP100; TMBIM1 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | U-251MG | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human TMBIM1 (NP_071435.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSNPSAPPPYEDRNPLYPGPPPPGGYGQPSVLPGGYPAYPGYPQPGYGHPAGYPQPMPPTHPMPMNYGPGHGYDGEERAVSDSFGPGEWDDRKVRHTFIR | Uniprot ID | Q969X1 |
Uniprot Id
Q969X1
Target Species
Human
Target Name
TMBIM1
Target Full Name
Protein lifeguard 3
Target Function
Negatively regulates aortic matrix metalloproteinase-9 (MMP9) production and may play a protective role in vascular remodeling.
Target Subcellular Location
Membrane; Multi-pass membrane protein. Lysosome membrane. Endosome membrane.
Target Protein Families
BI1 family, LFG subfamily
Target Synonyms
TMBIM1; LFG3; RECS1; PP1201; PSEC0158; Protein lifeguard 3; Protein RECS1 homolog; Transmembrane BAX inhibitor motif-containing protein 1
Target Background
Enables death receptor binding activity. Involved in negative regulation of Fas signaling pathway; negative regulation of extrinsic apoptotic signaling pathway via death domain receptors; and negative regulation of protein localization to plasma membrane. Located in Golgi apparatus; endosome membrane; and lysosomal membrane.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
