Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TMEM176B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-65 of human TMEM176B (NP_001094781.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TMEM176B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-65 of human TMEM176B (NP_001094781.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
Western blot analysis of various lysates, using TMEM176B Rabbit pAb at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 45s.
| Cat.No | ADA-08254A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TMEM176B |
| Target Synonyms | TMEM176B; LR8; MS4B2; transmembrane protein 176B | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, A549, Mouse lung, OVCAR-3, THP-1 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-65 of human TMEM176B (NP_001094781.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MTQNTVIVNGVAMASRPSQPTHVNVHIHQESALTQLLKAGGSLKKFLFHPGDTVPSTARIGYEQL | Uniprot ID | Q3YBM2 |
Uniprot Id
Q3YBM2
Target Species
Human
Target Name
TMEM176B
Target Full Name
Transmembrane protein 176B
Target Function
May play a role in the process of maturation of dendritic cells. Required for the development of cerebellar granule cells.
Target Subcellular Location
Nucleus membrane; Multi-pass membrane protein.
Target Protein Families
TMEM176 family
Target Tissue Specificity
Expressed in lung and dermal fibroblasts.
Target Synonyms
TMEM176B; LR8; Transmembrane protein 176B; Protein LR8
Target Background
Predicted to be involved in negative regulation of dendritic cell differentiation. Predicted to be located in nuclear membrane. Predicted to be integral component of membrane.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
