Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TMEM189 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 171-270 of human TMEM189 (NP_954580.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against TMEM189 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 171-270 of human TMEM189 (NP_954580.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-09056A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TMEM189 |
| Target Synonyms | KUA; CarF; TMEM189 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | MCF7 | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 171-270 of human TMEM189 (NP_954580.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | FVFCLIIFGTFTNQIHKWSHTYFGLPRWVTLLQDWHVILPRKHHRIHHVSPHETYFCITTGWLNYPLEKIGFWRRLEDLIQGLTGEKPRADDMKWAQKIK | Uniprot ID | A5PLL7 |
Uniprot Id
A5PLL7
Target Species
Human
Target Name
PEDS1
Target Full Name
Plasmanylethanolamine desaturase 1
Target Function
Plasmanylethanolamine desaturase involved in plasmalogen biogenesis in the endoplasmic reticulum membrane. Plasmalogens are glycerophospholipids with a hydrocarbon chain linked by a vinyl ether bond at the glycerol sn-1 position, and are involved in antioxidative and signaling mechanisms.
Target Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Target Synonyms
PEDS1; KUA; PDES; TMEM189; Plasmanylethanolamine desaturase; Plasmanylethanolamine desaturase 1; Transmembrane protein 189
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
