-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TMEM59 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 36-230 of human TMEM59 (NP_004863.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TMEM59 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 36-230 of human TMEM59 (NP_004863.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-10008A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TMEM59 |
| Target Synonyms | DCF1; C1orf8; PRO195; UNQ169; HSPC001; TMEM59 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-549, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 36-230 of human TMEM59 (NP_004863.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | EAFDSVLGDTASCHRACQLTYPLHTYPKEEELYACQRGCRLFSICQFVDDGIDLNRTKLECESACTEAYSQSDEQYACHLGCQNQLPFAELRQEQLMSLMPKMHLLFPLTLVRSFWSDMMDSAQSFITSSWTFYLQADDGKIVIFQSKPEIQYAPHLEQEPTNLRESSLSKMSYLQMRNSQAHRNFLEDGESDGF | Uniprot ID | Q9BXS4 |
Uniprot Id
Q9BXS4
Target Species
Human
Target Name
TMEM59
Target Full Name
Transmembrane protein 59
Target Function
Acts as a regulator of autophagy in response to S.aureus infection by promoting activation of LC3 (MAP1LC3A, MAP1LC3B or MAP1LC3C). Acts by interacting with ATG16L1, leading to promote a functional complex between LC3 and ATG16L1 and promoting LC3 lipidation and subsequent activation of autophagy. Modulates the O-glycosylation and complex N-glycosylation steps occurring during the Golgi maturation of several proteins such as APP, BACE1, SEAP or PRNP. Inhibits APP transport to the cell surface and further shedding.
Target Subcellular Location
Late endosome membrane; Single-pass type I membrane protein. Lysosome membrane; Single-pass type I membrane protein. Cell membrane; Single-pass type I membrane protein. Golgi apparatus membrane; Single-pass type I membrane protein.
Target Protein Families
TMEM59 family
Target Synonyms
TMEM59; C1orf8; HSPC001; UNQ169/PRO195; Transmembrane protein 59; Liver membrane-bound protein
Target Background
This gene encodes a protein shown to regulate autophagy in response to bacterial infection. This protein may also regulate the retention of amyloid precursor protein (APP) in the Golgi apparatus through its control of APP glycosylation. Overexpression of this protein has been found to promote apoptosis in a glioma cell line. Alternative splicing results in multiple transcript variants.
Notification