Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TMEM70 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 161-260 of human TMEM70 (NP_060336.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TMEM70 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 161-260 of human TMEM70 (NP_060336.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-10281A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TMEM70 |
| Target Synonyms | MC5DN2; TMEM70 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 161-260 of human TMEM70 (NP_060336.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | FITKGYVIRLYHEATTDTYKAITYNAMLAETSTVFHQNDVKIPDAKHVFTTFYAKTKSLLVNPVLFPNREDYIHLMGYDKEEFILYMEETSEEKRHKDDK | Uniprot ID | Q9BUB7 |
Uniprot Id
Q9BUB7
Target Species
Human
Target Name
TMEM70
Target Full Name
Transmembrane protein 70, mitochondrial
Target Function
Involved in biogenesis of mitochondrial ATP synthase.
Target Involvement
Mitochondrial complex V deficiency, nuclear 2 (MC5DN2)
Target Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.
Target Protein Families
TMEM70 family
Target Synonyms
TMEM70; Transmembrane protein 70, mitochondrial
Target Background
This gene likely encodes a mitochondrial membrane protein. The encoded protein may play a role in biogenesis of mitochondrial ATP synthase. Mutations in this gene have been associated with neonatal mitochondrial encephalocardiomyopathy due to ATP synthase deficiency. Alternatively spliced transcript variants have been described.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
