Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TMPRSS11A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 300-421 of human TMPRSS11A (NP_872412.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TMPRSS11A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 300-421 of human TMPRSS11A (NP_872412.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01151A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TMPRSS11A |
| Target Synonyms | HESP; ECRG1; HATL1; TMPRSS11A | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, A-549, Mouse liver, Rat liver, SW620 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 300-421 of human TMPRSS11A (NP_872412.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SASFQPNLTVHITGFGALYYGGESQNDLREARVKIISDDVCKQPQVYGNDIKPGMFCAGYMEGIYDACRGDSGGPLVTRDLKDTWYLIGIVSWGDNCGQKDKPGVYTQVTYYRNWIASKTGI | Uniprot ID | Q6ZMR5 |
Uniprot Id
Q6ZMR5
Target Species
Human
Target Name
TMPRSS11A
Target Full Name
Transmembrane protease serine 11A
Target Function
Probable serine protease which may play a role in cellular senescence. Overexpression inhibits cell growth and induce G1 cell cycle arrest.
Target Subcellular Location
Membrane; Single-pass type II membrane protein.
Target Protein Families
Peptidase S1 family
Target Tissue Specificity
Expressed in esophagus, liver, colon and lung. Down-regulated in esophagus cancers.
Target Research Area
Cell cycle
Target Synonyms
Airway trypsin-like protease 1; ECRG1; epidermal type II transmembrane serine protease; Epidermal type-II transmembrane serine protease; Esophageal cancer-susceptibility gene 1 protein; TM11A_HUMAN; Tmprss11a; TMPRSS11A protein; Transmembrane protease serine 11A
Target Background
Predicted to enable serine-type endopeptidase activity. Predicted to be involved in proteolysis. Predicted to be located in extracellular region. Predicted to be integral component of plasma membrane.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
