-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TNFAIP3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 450-550 of human TNFAIP3 (P21580) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against TNFAIP3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 450-550 of human TNFAIP3 (P21580) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-16548A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TNFAIP3 |
| Target Synonyms | A20; AISBL; AIFBL1; OTUD7C; TNFA1P2; TNFAIP3 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Jurkat | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 450-550 of human TNFAIP3 (P21580). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PEESTGGPHSAPPTAPSPFLFSETTAMKCRSPGCPFTLNVQHNGFCERCHNARQLHASHAPDHTRHLDPGKCQACLQDVTRTFNGICSTCFKRTTAEASSS | Uniprot ID | P21580 |
Uniprot Id
P21580
Target Species
Human
Target Name
TNFAIP3
Target Full Name
Tumor necrosis factor alpha-induced protein 3
Target Function
Ubiquitin-editing enzyme that contains both ubiquitin ligase and deubiquitinase activities. Involved in immune and inflammatory responses signaled by cytokines, such as TNF-alpha and IL-1 beta, or pathogens via Toll-like receptors (TLRs) through terminating NF-kappa-B activity. Essential component of a ubiquitin-editing protein complex, comprising also RNF11, ITCH and TAX1BP1, that ensures the transient nature of inflammatory signaling pathways. In cooperation with TAX1BP1 promotes disassembly of E2-E3 ubiquitin protein ligase complexes in IL-1R and TNFR-1 pathways; affected are at least E3 ligases TRAF6, TRAF2 and BIRC2, and E2 ubiquitin-conjugating enzymes UBE2N and UBE2D3. In cooperation with TAX1BP1 promotes ubiquitination of UBE2N and proteasomal degradation of UBE2N and UBE2D3. Upon TNF stimulation, deubiquitinates 'Lys-63'-polyubiquitin chains on RIPK1 and catalyzes the formation of 'Lys-48'-polyubiquitin chains. This leads to RIPK1 proteasomal degradation and consequently termination of the TNF- or LPS-mediated activation of NF-kappa-B. Deubiquitinates TRAF6 probably acting on 'Lys-63'-linked polyubiquitin. Upon T-cell receptor (TCR)-mediated T-cell activation, deubiquitinates 'Lys-63'-polyubiquitin chains on MALT1 thereby mediating disassociation of the CBM (CARD11:BCL10:MALT1) and IKK complexes and preventing sustained IKK activation. Deubiquitinates NEMO/IKBKG; the function is facilitated by TNIP1 and leads to inhibition of NF-kappa-B activation. Upon stimulation by bacterial peptidoglycans, probably deubiquitinates RIPK2. Can also inhibit I-kappa-B-kinase (IKK) through a non-catalytic mechanism which involves polyubiquitin; polyubiquitin promotes association with IKBKG and prevents IKK MAP3K7-mediated phosphorylation. Targets TRAF2 for lysosomal degradation. In vitro able to deubiquitinate 'Lys-11'-, 'Lys-48'- and 'Lys-63' polyubiquitin chains. Inhibitor of programmed cell death. Has a role in the function of the lymphoid system. Required for LPS-induced production of proinflammatory cytokines and IFN beta in LPS-tolerized macrophages.
Target Involvement
Autoinflammatory syndrome, familial, Behcet-like (AISBL)
Target Subcellular Location
Cytoplasm. Nucleus. Lysosome.; [A20p50]: Cytoplasm.
Target Protein Families
Peptidase C64 family
Target Synonyms
A20; AISBL; MGC104522; MGC138687; MGC138688; OTU domain containing protein 7C; OTU domain-containing protein 7C; OTUD7C; Putative DNA binding protein A20; Putative DNA-binding protein A20; TNAP3_HUMAN; TNF alpha-induced protein 3; TNFA1P2; TNFAIP 3; TNFAIP3 (A20); TNFAIP3; Tumor necrosis factor alpha induced protein 3; Tumor necrosis factor alpha-induced protein 3; Tumor necrosis factor induced protein 3; Tumor necrosis factor inducible protein A20; tumor necrosis factor, alpha-induced protein 3; Zinc finger protein A20
Target Background
This gene was identified as a gene whose expression is rapidly induced by the tumor necrosis factor (TNF). The protein encoded by this gene is a zinc finger protein and ubiqitin-editing enzyme, and has been shown to inhibit NF-kappa B activation as well as TNF-mediated apoptosis. The encoded protein, which has both ubiquitin ligase and deubiquitinase activities, is involved in the cytokine-mediated immune and inflammatory responses. Several transcript variants encoding the same protein have been found for this gene.
Notification