Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TNFSF10 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human TNFSF10 (NP_003801.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TNFSF10 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human TNFSF10 (NP_003801.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02115A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TNFSF10 |
| Target Synonyms | TL2; APO2L; CD253; TANCR; TRAIL; Apo-2L; TNLG6A; TNFSF10 | Form | Liquid |
| Species Reactivity | Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat lung | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human TNFSF10 (NP_003801.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAMMEVQGGPSLGQTCVLIVIFTVLLQSLCVAVTYVYFTNELKQMQDKYSKSGIACFLKEDDSYWDPNDEESMNSPCWQVKWQLRQLVRKMILRTSEETI | Uniprot ID | P50591 |
Uniprot Id
P50591
Target Species
Human
Target Name
TNFSF10
Target Full Name
Tumor necrosis factor ligand superfamily member 10
Target Function
Cytokine that binds to TNFRSF10A/TRAILR1, TNFRSF10B/TRAILR2, TNFRSF10C/TRAILR3, TNFRSF10D/TRAILR4 and possibly also to TNFRSF11B/OPG. Induces apoptosis. Its activity may be modulated by binding to the decoy receptors TNFRSF10C/TRAILR3, TNFRSF10D/TRAILR4 and TNFRSF11B/OPG that cannot induce apoptosis.
Target Subcellular Location
Cell membrane; Single-pass type II membrane protein. Secreted.
Target Protein Families
Tumor necrosis factor family
Target Tissue Specificity
Widespread; most predominant in spleen, lung and prostate.
Target Research Area
Apoptosis
Target Synonyms
Apo 2 ligand; APO 2L; Apo-2 ligand; Apo-2L; APO2L; CD253; CD253 antigen; Chemokine tumor necrosis factor ligand superfamily member 10; Protein TRAIL; TL2; TNF Related Apoptosis Inducing Ligand; TNF related apoptosis inducing ligand TRAIL; TNF-related apoptosis-inducing ligand; TNF10_HUMAN; TNFSF10; TRAIL; Tumor necrosis factor (ligand) family member 10; Tumor Necrosis Factor (ligand) Superfamily Member 10; Tumor necrosis factor apoptosis inducing ligand splice variant delta; Tumor necrosis factor ligand superfamily member 10
Target Background
The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This protein preferentially induces apoptosis in transformed and tumor cells, but does not appear to kill normal cells although it is expressed at a significant level in most normal tissues. This protein binds to several members of TNF receptor superfamily including TNFRSF10A/TRAILR1, TNFRSF10B/TRAILR2, TNFRSF10C/TRAILR3, TNFRSF10D/TRAILR4, and possibly also to TNFRSF11B/OPG. The activity of this protein may be modulated by binding to the decoy receptors TNFRSF10C/TRAILR3, TNFRSF10D/TRAILR4, and TNFRSF11B/OPG that cannot induce apoptosis. The binding of this protein to its receptors has been shown to trigger the activation of MAPK8/JNK, caspase 8, and caspase 3. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
