-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TNFSF12 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 42-123 of human TNFSF12 (NP_003800.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against TNFSF12 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 42-123 of human TNFSF12 (NP_003800.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-00275A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TNFSF12 |
| Target Synonyms | APO3L; DR3LG; TWEAK; TNLG4A; TNFSF12 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat kidney | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 42-123 of human TNFSF12 (NP_003800.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VSLGSRASLSAQEPAQEELVAEEDQDPSELNPQTEESQDPAPFLNRLVRPRRSAPKGRKTRARRAIAAHYEVHPRPGQDGAQ | Uniprot ID | O43508 |
Uniprot Id
O43508
Target Species
Human
Target Name
TNFSF12
Target Full Name
Tumor necrosis factor ligand superfamily member 12
Target Function
Binds to FN14 and possibly also to TNRFSF12/APO3. Weak inducer of apoptosis in some cell types. Mediates NF-kappa-B activation. Promotes angiogenesis and the proliferation of endothelial cells. Also involved in induction of inflammatory cytokines. Promotes IL8 secretion.
Target Subcellular Location
Cell membrane; Single-pass type II membrane protein.; [Tumor necrosis factor ligand superfamily member 12, secreted form]: Secreted.; [Isoform TWE-PRIL]: Cell membrane; Single-pass membrane protein.
Target Protein Families
Tumor necrosis factor family
Target Tissue Specificity
Highly expressed in adult heart, pancreas, skeletal muscle, brain, colon, small intestine, lung, ovary, prostate, spleen, lymph node, appendix and peripheral blood lymphocytes. Low expression in kidney, testis, liver, placenta, thymus and bone marrow. Als
Target Research Area
Cancer
Target Synonyms
APO 3 ligand; APO 3L; APO3 ligand; APO3/DR3 ligand; APO3L; DR3LG; MGC129581; MGC20669; secreted form; TNF-related weak inducer of apoptosis; TNF12_HUMAN; TNFSF 12; Tnfsf12; TNFSF12 protein; Tumor necrosis factor (ligand) superfamily member 12; Tumor necrosis factor ligand superfamily member 12; Tumor necrosis factor superfamily member 12; TWEAK; UNQ181/PRO207
Target Background
The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This protein is a ligand for the FN14/TWEAKR receptor. This cytokine has overlapping signaling functions with TNF, but displays a much wider tissue distribution. This cytokine, which exists in both membrane-bound and secreted forms, can induce apoptosis via multiple pathways of cell death in a cell type-specific manner. This cytokine is also found to promote proliferation and migration of endothelial cells, and thus acts as a regulator of angiogenesis. Alternative splicing results in multiple transcript variants. Some transcripts skip the last exon of this gene and continue into the second exon of the neighboring TNFSF13 gene; such read-through transcripts are contained in GeneID 407977, TNFSF12-TNFSF13.
Notification