Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TNNC2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-160 of human TNNC2 (NP_003270.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against TNNC2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-160 of human TNNC2 (NP_003270.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-00067A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TNNC2 |
| Target Synonyms | FAP85; CFAP85; CMYP15; MYONRI; TNNC2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HT-29, Mouse brain, U-937 | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-160 of human TNNC2 (NP_003270.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MTDQQAEARSYLSEEMIAEFKAAFDMFDADGGGDISVKELGTVMRMLGQTPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMKEDAKGKSEEELAECFRIFDRNADGYIDPEELAEIFRASGEHVTDEEIESLMKDGDKNNDGRIDFDEFLKMMEGVQ | Uniprot ID | P02585 |
Uniprot Id
P02585
Target Species
Human
Target Name
TNNC2
Target Full Name
Troponin C, skeletal muscle
Target Function
Troponin is the central regulatory protein of striated muscle contraction. Tn consists of three components: Tn-I which is the inhibitor of actomyosin ATPase, Tn-T which contains the binding site for tropomyosin and Tn-C. The binding of calcium to Tn-C abolishes the inhibitory action of Tn on actin filaments.
Target Protein Families
Troponin C family
Target Research Area
Signal Transduction
Target Synonyms
TNNC2; Troponin C; skeletal muscle
Target Background
Troponin (Tn), a key protein complex in the regulation of striated muscle contraction, is composed of 3 subunits. The Tn-I subunit inhibits actomyosin ATPase, the Tn-T subunit binds tropomyosin and Tn-C, while the Tn-C subunit binds calcium and overcomes the inhibitory action of the troponin complex on actin filaments. The protein encoded by this gene is the Tn-C subunit.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
