Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TNNT3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 147-256 of human TNNT3 (NP_001036246.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TNNT3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 147-256 of human TNNT3 (NP_001036246.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05140A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TNNT3 |
| Target Synonyms | TNTF; DA2B2; beta-TnTF; TNNT3 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse skeletal muscle, Rat lung, Rat skeletal muscle | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 147-256 of human TNNT3 (NP_001036246.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SMGANYSSYLAKADQKRGKKQTAREMKKKILAERRKPLNIDHLGEDKLRDKAKELWETLHQLEIDKFEFGEKLKRQKYDITTLRSRIDQAQKHSKKAGTPAKGKVGGRWK | Uniprot ID | P45378 |
Uniprot Id
P45378
Target Species
Human
Target Name
TNNT3
Target Full Name
Troponin T, fast skeletal muscle
Target Function
Troponin T is the tropomyosin-binding subunit of troponin, the thin filament regulatory complex which confers calcium-sensitivity to striated muscle actomyosin ATPase activity.
Target Involvement
Arthrogryposis, distal, 2B (DA2B)
Target Protein Families
Troponin T family
Target Tissue Specificity
In fetal and adult fast skeletal muscles, with a higher level expression in fetal than in adult muscle.
Target Synonyms
AMCD2B; Beta TnTF; Beta-TnTF; DA2B; DKFZp779M2348; fast skeletal muscle; Fast skeletal muscle troponin T; FSSV; fTnT; TNNT 3; Tnnt3; TNNT3_HUMAN; TnTf; Troponin T; Troponin T fast skeletal muscle; Troponin T type 3 (skeletal fast); Troponin T type 3; Troponin T3 skeletal fast
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
